(data stored in ACNUC7421 zone)

EMBL: CP001600.PE369

CP001600.PE369       Location/Qualifiers
FT   CDS_pept        405764..406309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0399"
FT                   /product="exonuclease family protein"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67640"
FT                   /db_xref="GOA:C5BDM4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM4"
FT                   /protein_id="ACR67640.2"
FT                   /translation="MSASETRLIWIDLEMTGLDPQRDRIIEIATLVTDADLNVLAEGPV
FT                   IALHQDDAQLALMDEWNVRTHTASGLVARVKASQYDDAAAEQATLDFLRQWVPAGVSPI
FT                   CGNSVGQDRRFLFRYMPELERYFHYRYLDVSTLKELARRWKPEILEGFKKRNTHQALDD
FT                   IRESVAELTYYRTHFIQP"
     atgagtgcaa gtgaaacgcg tttgatttgg atcgatctgg aaatgaccgg gttggatccg        60
     cagcgcgacc ggatcatcga gatcgccacg ctggtgacgg atgccgatct gaacgtgctg       120
     gcggaggggc cggtgattgc gctgcatcag gatgacgccc agctggcgct gatggacgag       180
     tggaatgtac gtacccatac cgccagcggg ctggtggcgc gggtgaaggc cagtcagtac       240
     gatgatgcgg ccgccgaaca ggcgaccctc gactttttgc gtcagtgggt acccgccggc       300
     gtttctccga tctgtggcaa cagcgtcggc caggatcgtc gcttcctgtt ccgctatatg       360
     ccggagctgg agcgctattt ccactaccgc tatctggatg tcagtaccct gaaagagctg       420
     gcgcgtcgtt ggaagccgga gatcctggag ggattcaaga agaggaatac ccatcaggcg       480
     ctggacgata ttcgtgaatc ggtggctgag ctgacgtatt accgtacgca ttttatccag       540
     ccatag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page