(data stored in ACNUC7421 zone)

EMBL: CP001600.PE370

CP001600.PE370       Location/Qualifiers
FT   CDS_pept        complement(407106..408245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0403"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67641"
FT                   /db_xref="GOA:C5BDM5"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM5"
FT                   /protein_id="ACR67641.1"
FT                   /translation="MTHPLDLHQLAQHIKQWGLSLGFQQVGIGDTDLRAEEAPLQAWLD
FT                   SGYHGDMAWMARHGMMRARPAELLPGTLRVISVRMNYLPPSAAFASTLKDPTLGYISRY
FT                   ALGRDYHKVLRARLKKLGEMIQAYCGELRFRPFVDSAPLLERPLAAKAGLGWTGKHSLL
FT                   LNPQAGSWFFLGELLIDLPLPVDTPQTAQCGRCVACITTCPTDAIVAPYKVDARRCISY
FT                   LTIELEGAIPEALRPLLGNRIYGCDDCQMICPWNRLAPLSEEADFLPRAALHAPPLTIL
FT                   FAWDETTFLRMTEGSPIRRIGYQRWLRNLSVALGNAPYDAHIVTLLQQRLGVSALLDEH
FT                   IHWALAQQLQKRAAQAVEVVSSQQRRLIRAVEKGLPRDA"
     atgactcatc ccctcgatct gcatcaatta gcccaacata tcaagcaatg gggtctatcg        60
     ctaggcttcc agcaggtcgg gatcggcgat acggatctcc gcgccgaaga ggcgccgctg       120
     caggcgtggc tggacagcgg ctaccatgga gatatggcgt ggatggcgcg ccacggtatg       180
     atgcgcgccc ggccggccga gctgctgccc ggcacgctgc gggtgattag cgtgcgcatg       240
     aactacctgc cgcccagcgc cgcctttgcc tcgaccctga aagatccgac actgggctac       300
     atcagccgct atgcgctggg tcgcgactac cataaggtgc tgcgcgcccg gctaaaaaag       360
     ctgggcgaaa tgatccaggc atactgcggt gaactccgct tccgcccctt cgtggactcg       420
     gcgccgctgc tggagcgccc gctggctgcc aaggcgggac tgggctggac agggaaacat       480
     tcgctgctgc tcaacccgca ggccggctcc tggttctttc tcggcgaact gttaatcgat       540
     ctgccgctgc ccgtcgatac gccgcagacg gcgcagtgcg gccgctgcgt cgcctgtatc       600
     accacctgcc cgaccgacgc catcgtcgcc ccctataagg tcgacgcgcg ccgctgcatc       660
     tcctatctga cgatcgagct ggagggcgcc atccccgagg cgctgcggcc cctgctcggt       720
     aaccgcatct acggctgcga tgactgccag atgatttgcc cgtggaaccg cctggccccg       780
     ctgagcgagg aggccgattt tctgccgcgg gcggcgctgc acgcgccacc gctaaccatc       840
     ctgttcgcct gggatgagac gacctttctg cggatgaccg aaggctcgcc cattcggcgc       900
     atcggctatc agcgctggct gcgcaacctg agcgtcgcct tgggcaacgc gccctatgat       960
     gcccatatcg tcaccctgct acagcagcgc ctgggcgtca gcgcgctgtt ggatgagcat      1020
     attcactggg cgctggcgca gcagctgcaa aaacgcgcag cgcaagcggt agaggttgtc      1080
     agcagtcagc agcgccggct tattcgcgca gtagagaaag ggctgccgcg cgacgcctga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page