(data stored in ACNUC7421 zone)

EMBL: CP001600.PE371

CP001600.PE371       Location/Qualifiers
FT   CDS_pept        408247..409740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0404"
FT                   /product="YjeF-like protein, C-terminus"
FT                   /note="YjeF homolog, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67642"
FT                   /db_xref="GOA:C5BDM6"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM6"
FT                   /protein_id="ACR67642.1"
FT                   /translation="MGHSCNRNIDSLSHYVAPADWVRDAETRAVAAQGIALATLMQRAG
FT                   LAAFNRGRQCYPTSRRWLILCGRGNNGGDGYVIARLARASGLQVTLMAVAGDSPLPPEA
FT                   QQARAQWLQCGGSEIAASLPLPAAEVIVDALLGIGLSSAPRAPYDALISAINAHSAPVL
FT                   SIDLPSGLNADTGAAAGAVVRADHTQSFICLKPGLLTGLARAVVGQLHCDPLGLTVWLA
FT                   QQDWPLQRLDGHCLPRWLAPRSPLAHKGDNGRLLLIGGDSGMGGAIRLAGQAALRSGAG
FT                   LVRVLTRGEHVAPLLAAAPELMVKALSRDTLREALSWAEAVVVGPGLGQGEWGQMVLAA
FT                   LASVRKPMLWDADALNLLSGAPSVCEWRVMTPHPGEAARLLGCGIADVENDRPAAVRAL
FT                   QRRYGGVALLKGAGTLIADDARCAIADVGNPGMASGGMGDILSGIIGGLLAQKLTLYDA
FT                   ACAGAVLHGVAADAAALRDGERGMLASDLLPEIRRWANP"
     atgggccatt cttgcaaccg gaacatcgac agtttatcac actatgtggc gccagcggac        60
     tgggttcgcg acgccgagac gcgcgcggtc gcggcgcagg ggatcgcgct ggcgacgctg       120
     atgcagcgcg ccggtctggc tgcctttaac cgcgggcgcc agtgctaccc cacctcccgc       180
     cgctggctga tcctgtgcgg tcgcggtaat aacggcggcg atggctatgt gatcgcgcgc       240
     ctggcgcgcg ccagcggcct gcaggtcacg ctgatggcgg tggcggggga ctctcccctg       300
     ccgccggagg cgcagcaggc ccgtgcgcag tggttgcagt gcggcggcag cgagatcgcg       360
     gcatcgctgc ccctgccggc ggcagaggtg atcgtggatg cgctgctggg catcggtctg       420
     tcgtccgcgc cgcgagcccc ctatgatgcg ctgattagcg cgataaatgc ccattctgcg       480
     ccggtgctct ccatcgatct gccctccggg ctgaatgctg atacgggcgc ggcggccggc       540
     gccgtggtgc gggccgatca tacccagagc tttatctgtc tcaagccggg gctgttgacc       600
     gggctggcgc gtgcggtcgt cgggcagctg cactgcgatc cgctggggtt gacggtgtgg       660
     ctggcgcagc aggactggcc gctgcagcgc ctggatgggc actgtctgcc gcgttggctg       720
     gcaccgagat cgccgctggc gcataagggg gataacggcc ggctgctgct gatcggaggc       780
     gatagcggta tggggggggc gattcgtctg gccgggcagg ccgcactgcg cagcggcgcc       840
     ggactggtca gggtattgac ccgtggggag cacgtagctc cgctgctggc cgcagcgcca       900
     gagctgatgg tgaaggcgct gagccgggat acgctgaggg aggcgctgag ctgggccgag       960
     gcggtggtcg tgggcccggg gctggggcag ggcgagtggg ggcagatggt cttggccgcg      1020
     ctggcatcgg tgcgtaagcc gatgctgtgg gatgccgacg ccctgaacct gctgtccggc      1080
     gcgcccagcg tctgtgaatg gcgggtgatg acgccacacc ccggcgaggc ggcacgtctg      1140
     ctcggctgcg gcattgccga tgtggaaaac gatcggcccg cggcggtgcg ggcgctacag      1200
     cgtcgctatg gcggggtggc gcttctcaag ggcgcgggta cgctgatcgc ggatgatgcg      1260
     cgctgcgcaa ttgctgatgt cggtaatcct gggatggcaa gtggcggtat gggtgacata      1320
     ctctctggta tcattggcgg tttgctggcg caaaagctca cgctgtatga tgcagcctgc      1380
     gccggcgccg tgttacacgg cgtggcggcc gacgccgctg cgctgcgcga cggcgagcgg      1440
     ggtatgctgg ccagtgactt gctgcctgag atcaggcgct gggccaaccc ttga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page