(data stored in ACNUC7421 zone)

EMBL: CP001600.PE372

CP001600.PE372       Location/Qualifiers
FT   CDS_pept        409771..410235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0405"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67643"
FT                   /db_xref="GOA:C5BDM7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM7"
FT                   /protein_id="ACR67643.1"
FT                   /translation="MTSIVLQLPDEAATIVLGGALARACQRATVIYLYGDLGAGKTTFS
FT                   RGFLQAMGHQGTVKSPTYTLVEPYPLAPRPVYHFDLYRLADPEELEFMGIRDYFAQDAL
FT                   LLVEWPQQGMGFLPEPDITLHLTYTDGGRQAVIEAHSVHGQGVLAALDGQ"
     atgacaagta tcgtactgca attgccggat gaagcggcaa ccattgtcct gggcggcgcg        60
     ttggcgcggg cctgtcagcg tgccactgta atttatctgt acggcgatct gggggcgggc       120
     aaaaccacct tcagccgcgg ttttctgcag gccatggggc atcagggaac ggtgaaaagc       180
     ccgacctata cgctggtgga gccctatccg ctcgcgccgc gtccggtgta tcactttgat       240
     ctgtatcgct tagccgatcc cgaagagctg gagtttatgg ggatccgcga ctactttgcc       300
     caggatgcgc tgctgctggt ggagtggccg cagcagggaa tgggcttttt accggagccg       360
     gatatcaccc tgcatctgac ctataccgac ggtggccgcc aggcggtgat tgaagcgcac       420
     agcgtacatg gccagggcgt tttggctgca ttggacgggc aataa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page