(data stored in ACNUC7421 zone)

EMBL: CP001600.PE374

CP001600.PE374       Location/Qualifiers
FT   CDS_pept        411900..413819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0407"
FT                   /product="DNA mismatch repair protein MutL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67645"
FT                   /db_xref="GOA:C5BDM9"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BDM9"
FT                   /protein_id="ACR67645.1"
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGGGIGKAELALALARHATSKISTLDDLEAIVSLGFRGEALASISS
FT                   VSRLTMTSRPEGQAEAWQAYAEGREMAVMVKPSAHPVGTTVEVLDLFYNTPARRKFLRT
FT                   EKTEFAHIDEVVRRIALARFDITLTLQHNGKTVRQYRAVKEGDARERRLGAICGPVFVQ
FT                   HALALTWRHDELAIHGWVAAPQAIRQIGELQYCYVNGRMMRDRLITHAIRQAYQDRLSD
FT                   EMPPAYVLYLEIDPRQVDVNVHPAKHEVRFHQARLVHDFIYQAVVEVLQQAQVASAHDD
FT                   PTPAISGAARDEEPRGVENRASAGENRFNRPASSPVASAPRPAHVAAPRMPAGDIFRRR
FT                   EGELYQRLLAANPAPAAETDSAFVAAPGAPVTVAGPPAVAVSTAAENGAPGDSFGRVLT
FT                   LCADGVALTECRSGVALVSLFHARRCLLRAQLQPPDEGLKAQPLLVPLRLTLEAAERQA
FT                   LKTQQPLLQQMGLRLQPERQHALLHAVPLPLRQQNLPRLIPQMLRYLATASVCDAASLA
FT                   DWLAAHWHSADEAPWTVAQAVQLLADLERLCPQLVQSPPRALLQPLDLQPGVDRLRQEE
FT                   QLNE"
     atgccgattc agatcctgcc gccgcagctg gcgaatcaaa ttgccgccgg cgaggtggtg        60
     gagcgtccgg catcggtggt caaagagctg gtggagaaca gtctggatgc cggcgcgacc       120
     cgcatcgata tcgatattga gcgcggcggt gccaagctga tccgtatccg ggataacggc       180
     ggcggtatcg gcaaggcgga gctggcgctg gcgctggctc ggcatgccac cagtaagatc       240
     agtacgttgg acgatcttga ggcgatcgtc agcctggggt ttcgcggcga ggcgttggcc       300
     agcatcagct cggtatcccg tctgacgatg acctcgcgtc ccgaagggca ggcggaggcc       360
     tggcaggcct atgccgaagg gcgggagatg gcggtgatgg tcaagccatc agcgcacccg       420
     gtcggcacta cggtagaggt gctggatctg ttctacaaca ccccggcccg gcgcaagttc       480
     ctgcgtaccg agaagaccga gtttgcccat atcgacgagg tggtgcggcg gattgccttg       540
     gcccgctttg acattactct gacgctgcag cataacggta aaacagtgcg ccagtaccgg       600
     gcggtcaagg agggtgacgc gcgggagcgc cgcctgggcg cgatctgcgg gccggtgttt       660
     gtacagcatg cgctggcgct gacgtggcgc catgacgagc tggccattca cggctgggta       720
     gccgcgccgc aggctatccg ccagataggc gagctgcagt attgctatgt taacgggcgg       780
     atgatgcgcg atcggctgat tacccatgcc atccgtcagg cttaccagga tcgcctgagc       840
     gatgagatgc caccggccta tgtgctgtat ctggagatcg acccccgtca ggtcgatgtc       900
     aacgtccacc cggccaagca cgaggtgcgc tttcatcagg cgcgtctggt gcacgatttt       960
     atctatcagg ccgtcgtcga agtgctgcag caggcgcagg ttgccagcgc tcacgatgac      1020
     ccgacgccag cgatctcggg cgcagcgcgg gacgaggagc ctcggggcgt cgaaaatcgg      1080
     gcttctgcgg gggaaaaccg gtttaaccgt ccggcctctt cgccggtcgc gtcagcgccc      1140
     cggccggcgc atgtggccgc accacgtatg cctgccggtg atattttccg tcgccgtgag      1200
     ggcgaactgt atcagcgtct gctggcggca aacccggccc cggcagcgga gacggatagc      1260
     gcgtttgtcg ccgcgcccgg cgcgccggtg acggtggccg ggccgcccgc cgtggcggtc      1320
     tctaccgctg cggaaaacgg ggcgccgggc gacagctttg ggcgggtgct gacgctgtgc      1380
     gccgatgggg tcgccttgac cgagtgtcgc agcggcgtgg cgctggtcag tctgttccat      1440
     gcgcgccgtt gcctgctgcg cgcccagttg cagcccccgg atgaagggct gaaggcgcag      1500
     cctctgctgg taccgttgcg tctgaccctt gaggccgcag agcggcaggc gctgaagacg      1560
     cagcaaccgc tgctgcagca gatggggctc cgcctgcagc cagagcgcca gcatgcgctg      1620
     ctgcatgcgg tgccgctgcc gctgcgacag caaaatctgc cgcggctgat cccccagatg      1680
     ctgcgctatc tggcgacggc ctctgtgtgc gacgccgcat cgctggcgga ctggctcgct      1740
     gctcactggc acagcgctga cgaggcgcct tggacggtgg cgcaggcggt gcaactgttg      1800
     gccgatcttg aacgactctg tccccagctg gtacagtcgc cgccccgcgc gctgctgcag      1860
     ccgctggatt tacagcccgg cgtcgatcga ttgcgccagg aagaacaact gaatgagtaa      1920
//

If you have problems or comments...

PBIL Back to PBIL home page