(data stored in ACNUC7421 zone)

EMBL: CP001600.PE378

CP001600.PE378       Location/Qualifiers
FT   CDS_pept        416674..417933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0411"
FT                   /product="HflK protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67649"
FT                   /db_xref="GOA:C5BDN3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDN3"
FT                   /protein_id="ACR67649.1"
FT                   /translation="MAWNQPGNNGQNRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDL
FT                   FRKVSKKLGGLGGGKSGGSGSAGTPRSSIGGKKVVGLAVAAVVVIWAASGFYTIKEAER
FT                   GVVTRFGKFSHLVQPGLNWKPTFIDDVIPVNVESVRELAASGVMLTSDENVVRVEMNVQ
FT                   YRVTNPEEYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTEGRTVIRNDTQKVLEEI
FT                   IRPYHMGITILDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQ
FT                   AQRILEDAKAYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLYLETMERVLGHTRKV
FT                   LVDDKSNNLMVLPLDQIMRSGDKGASQAGDSKDTSLIRLNPPQASSKPVSAGSSTDSSV
FT                   MDQRRVNAQRNDTTRLGRDY"
     atggcgtgga atcagcccgg taataacgga cagaaccgcg acccgtgggg gagcagcaat        60
     aataatggcg gcaactccgg cggcaacaat aataaagggg ggcgcgatca ggggcctccg       120
     gatctggatg atctgttccg taaagtgagt aagaagctgg gcggactggg cggcggcaaa       180
     agcggcggtt ctggctcggc aggaaccccg cgttcctcta tcggcggtaa aaaagtggtg       240
     gggctggccg tcgcggcagt ggtggtgatc tgggccgcca gcggcttcta taccatcaag       300
     gaagcggagc gtggcgtcgt gacccgcttt ggcaagttca gccacctggt tcaaccgggt       360
     ctgaattgga agccgacctt tatcgatgat gtcattccgg ttaacgtcga gtcggtgcgt       420
     gagctggctg cctccggggt catgctgacc tctgacgaaa acgtcgtgcg cgttgagatg       480
     aacgtacagt accgggtgac caatccggaa gagtatctgt ttaacgtgac caatgccgac       540
     gacagcctgc gtcaagctac ggacagcgcc ctgcgcgcgg tgatcggcaa gtacaccatg       600
     gacaccatcc tgacggaagg gcgtaccgtt attcgtaatg atacccagaa ggtgctggag       660
     gagatcatcc gtccgtacca catgggaatc accattctgg atgtgaactt ccaggcggcc       720
     cgtccgccgg aagaggtgaa ggctgccttt gacgacgcca ttgccgcgcg tgaaaacgaa       780
     cagcagtaca tccgtgaggc tgaagcctac gctaacgaag tccagccgcg tgctaacggt       840
     caggctcagc gtatcctgga agatgcgaag gcatataaag atcgtaccgt gctggaggct       900
     cagggtgagg tggggcgctt ctcccgtctg ctgccggagt acaaggcatc gccggagatc       960
     acccgcgagc gtctgtatct ggagaccatg gagcgcgtgc tgggtcatac ccgcaaggtg      1020
     ctggtagatg ataagagcaa caacctgatg gtgctgccgc tggatcaaat catgcgctcg      1080
     ggcgataaag gcgccagcca ggccggagac agcaaagata ccagcctgat ccggctcaat      1140
     ccgccgcagg ccagcagcaa gccggtcagc gcgggcagca gcacggacag cagcgtgatg      1200
     gaccagcgtc gcgtcaacgc acagcgtaac gataccactc gactggggag agattattaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page