(data stored in ACNUC7421 zone)

EMBL: CP001600.PE379

CP001600.PE379       Location/Qualifiers
FT   CDS_pept        417933..418937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0412"
FT                   /product="HflC protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67650"
FT                   /db_xref="GOA:C5BF64"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF64"
FT                   /protein_id="ACR67650.1"
FT                   /translation="MRKSLLVILIVVLVALYASLFVVQEGQRGIVLRFGKVLRDDENKP
FT                   LVYAPGLHLKIPFIESVKMLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDIKDIVTDSRGKLMEDVRNALNTGTVDDA
FT                   AAPTEADDAIASAAARVARETSGKQPAVNPNSMAALGIQVVDVRIKQINLPTEVSDAIY
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAEREGRIIRGEGDAKAAKLF
FT                   ANAFSKDPDFFAFIRSLKAYENSFKGGQDVMVLRPDSDFFKYMKSPDGGKNAK"
     atgcgtaagt ctttgttagt gattctcatc gtcgtgctgg tggcgctgta cgcttcactg        60
     tttgtggttc aggaggggca gcgtggcatc gtgctgcgtt tcggtaaggt gctgcgcgat       120
     gatgaaaaca agccgctggt gtatgcccct ggcctgcatc tcaagatacc ctttatcgaa       180
     tcggttaaga tgctggatgc ccgtatccag acgatggaca accaggccga ccgtttcgtg       240
     accaaagaga agaaagacct gatcgttgac tcctatatca agtggcgtat cagcgatttc       300
     agccgttact atctggcgac cggcggcggc gatgtgtcgc aggccgaggt gctgctgaag       360
     cgtaagttca gcgaccgtct gcgctccgag attggccgtc tggatatcaa ggatatcgtg       420
     acggattcgc gtggtaagct gatggaagac gtgcgtaatg ccctgaacac cggtacggtg       480
     gacgatgcgg cggcgccgac cgaggccgat gacgctatcg ccagcgcggc agcgcgcgtg       540
     gcacgggaga ccagcggcaa gcagccggcg gtgaacccca acagtatggc ggctctgggg       600
     atccaggtgg tggatgtgcg tatcaagcag atcaacctgc cgactgaggt gtccgacgct       660
     atctatcagc gtatgcgtgc cgagcgtgag gcggtagccc gtcgtcaccg ttcacaggga       720
     caggaagagg ctgaaaagct gcgcgcgacc gcagactatg aggtgacccg tactctggcg       780
     gaagcggagc gtgaaggccg tatcattcgc ggtgagggcg atgctaaggc agcgaagctg       840
     tttgccaatg ccttcagtaa ggatccggac ttctttgcct ttatccgcag cctgaaagcc       900
     tatgagaata gctttaaggg gggacaggat gtgatggtac tgcgcccgga cagcgacttc       960
     ttcaagtata tgaagtcgcc ggacggcggc aaaaacgcaa agtaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page