(data stored in ACNUC7421 zone)

EMBL: CP001600.PE38

CP001600.PE38        Location/Qualifiers
FT   CDS_pept        complement(33952..34089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67300"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C0"
FT                   /protein_id="ACR67300.1"
FT                   /translation="MAPDISAQPFLKLAWKNKDVFIIHKIYLYKSKKTGKDTWFFPCAP
FT                   "
     atggccccag acatctcagc gcagccattc cttaaactgg catggaagaa taaggacgta        60
     tttataatac ataaaatata tttatacaag agcaaaaaaa ccggcaaaga cacctggttt       120
     tttccatgcg cgccttga                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page