(data stored in ACNUC7421 zone)

EMBL: CP001600.PE381

CP001600.PE381       Location/Qualifiers
FT   CDS_pept        420569..420751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0414"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67652"
FT                   /db_xref="GOA:C5BF66"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF66"
FT                   /protein_id="ACR67652.1"
FT                   /translation="MALALVLVVEGLGPMLFPQAWRRMIATMAQLPDGLLRRYGGGLVV
FT                   AGLVIYYMLRSRLGG"
     atggcattgg cgctggtttt ggtcgttgaa gggctagggc cgatgctctt tccgcaggcc        60
     tggcgacgga tgatcgccac gatggcgcag ctgcctgatg gtttattgcg ccgctatggc       120
     ggaggtctag tggttgctgg gctggttatc tactacatgt tgcgtagtcg cctcggcggc       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page