(data stored in ACNUC7421 zone)

EMBL: CP001600.PE387

CP001600.PE387       Location/Qualifiers
FT   CDS_pept        complement(426212..426487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0420"
FT                   /product="Protein of unknown function (DUF1471)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67658"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF72"
FT                   /protein_id="ACR67658.1"
FT                   /translation="MSRSPLFTSLLFSIGLIGTSAQSAEYARADLVTDLSRMGMISLRG
FT                   ILGNPQDVERSIAHQADQRGARYYRILHMWESDGQQGWQATAALYR"
     atgagccgtt ccccgctatt cacatcactg cttttctcta ttggcctgat cggcacctcg        60
     gcacagtcgg ccgagtatgc ccgcgccgat ctcgtcaccg atctcagcag gatggggatg       120
     atctccctca gggggatcct gggaaatccc caggatgtcg agcggagcat agcccatcag       180
     gcagaccagc gcggcgcccg ctattaccgc attctacaca tgtgggaaag cgacggtcag       240
     cagggatggc aggcgacggc cgcgctctac cgctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page