(data stored in ACNUC7421 zone)

EMBL: CP001600.PE388

CP001600.PE388       Location/Qualifiers
FT   CDS_pept        complement(426664..426975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0421"
FT                   /product="Protein of unknown function (DUF1471)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67659"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF73"
FT                   /protein_id="ACR67659.1"
FT                   /translation="MKACKLTLTLLLTLLLGACSVMDGKPMPPPPPIAGHAQELRRNQT
FT                   EGLSKMWNISASVYGSPMNVQEVIQQRADAAGARYYYIVMLQENRVPGQWYSVATLYR"
     atgaaagcct gcaaactgac cctgaccctt ctgttgaccc tgctgctggg ggcctgcagc        60
     gtaatggacg gcaagccgat gccgccgccg ccgccgatcg caggccacgc gcaggaactg       120
     cgccgtaacc agaccgaagg gctgagcaaa atgtggaata ttagtgccag tgtctatggc       180
     agcccgatga atgttcagga ggttattcag cagagggcgg atgccgccgg cgcccgctat       240
     tactatattg tgatgctgca ggagaacagg gtgccgggcc agtggtatag cgtggcgacg       300
     ctgtaccgct aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page