(data stored in ACNUC7421 zone)

EMBL: CP001600.PE39

CP001600.PE39        Location/Qualifiers
FT   CDS_pept        34182..34766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0041"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67301"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C1"
FT                   /protein_id="ACR67301.1"
FT                   /translation="MTKQKILIIESRSALDIYDERCEGNTLRQVLELQGVAAKCTEVIN
FT                   KGMLLKALKIAQREHIKYVHISAHGSSDGFTLTDGDSISWKDFDKIAWPILKGKCICFS
FT                   SCSVGRGAEQLFDFHKSFCNAIVGPIRDITWGEGLVAYSAFYHRAQSYEKSSFQDVRVM
FT                   NNIVGAGTFRFIASPYISSTYTIDGSLKQGC"
     atgacaaaac aaaaaatatt gattattgaa tcacgcagcg ctctggatat ttatgatgaa        60
     cgatgcgagg gaaatacgct caggcaggtt ttggaattac aaggggtagc ggcaaagtgt       120
     actgaagtga ttaataaagg aatgctgctc aaagcattaa agatagcgca acgagaacac       180
     ataaaatatg tacacattag tgcgcatgga tcaagtgatg gctttacgtt aacggatggt       240
     gattccattt catggaagga ttttgataaa atagcatggc ctatattaaa agggaagtgc       300
     atttgttttt ccagttgttc tgtcggtagg ggggcggagc aattgttcga tttccataaa       360
     tctttttgta acgcaatcgt cggccctatc agggacataa cgtggggaga gggacttgtt       420
     gcatattcgg cattttatca tcgcgcacaa tcttacgaaa aatcatcttt tcaggatgtt       480
     cgggtaatga ataatattgt tggtgcaggg acctttagat ttatagcatc accttatata       540
     tcatcaacct atacaattga tggatctcta aagcagggtt gttaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page