(data stored in ACNUC7421 zone)

EMBL: CP001600.PE390

CP001600.PE390       Location/Qualifiers
FT   CDS_pept        427142..427891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0423"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67661"
FT                   /db_xref="GOA:C5BF75"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF75"
FT                   /protein_id="ACR67661.2"
FT                   /translation="MVEMFEQTVGGIPLLHAVPAGQRDSALPTIFFYHGFTSSKEMYSY
FT                   FGYAFAAAGFRVLLPEADMHGSRYDGDERRRLAHFWDILKSNIDELPSLYDHFLRAGLI
FT                   LDGRVGVAGASLGGMTALGAKARYPWLRATASFMGSGFYLSLSQRLFPRQHQPTEDERE
FT                   WVRQRVSALADYDVSGRLAQLADRPLLIWHGLADDLVPAAESQRLAQALASHHLMDNVS
FT                   VVTEPGIAHKITASALACGTAFFSRRL"
     atggttgaaa tgttcgaaca gacggtgggc gggatcccgc tgctgcacgc cgtacccgcg        60
     ggtcagcgcg acagcgcttt gccgacgatc tttttttatc atggattcac ctcctctaag       120
     gagatgtact cctattttgg ctatgccttt gccgctgcag gatttcgcgt attgctgccg       180
     gaggcggata tgcatggcag ccgctatgac ggcgatgagc gccgccgtct ggcccatttc       240
     tgggatattc taaaatcgaa tatcgatgag ctgccgtcgc tgtatgacca tttcctgcgt       300
     gcggggctga ttctggacgg gcgggtgggg gtcgcgggcg cctcgctggg cggaatgacg       360
     gcgctgggcg ccaaggctcg ctatccctgg ctacgcgcca ctgccagctt tatgggatcg       420
     ggtttttatc tgtcgctgtc gcagcgtctg tttccccgtc agcatcagcc aacggaggat       480
     gagcgggagt gggttcgcca gcgggtaagt gcgctggccg actatgacgt cagcgggcgc       540
     ctggcgcagc tggcggatag gccgttgctg atttggcacg gtttggcgga tgatctggtg       600
     cctgcggccg agagtcagcg tctggcgcag gcgctggcgt cacatcatct gatggataac       660
     gtcagcgtgg tgaccgagcc gggcattgcc cataagatca cggcgtcagc gctggcctgc       720
     ggtacggcgt ttttcagtcg ccgcctgtaa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page