(data stored in ACNUC7421 zone)

EMBL: CP001600.PE392

CP001600.PE392       Location/Qualifiers
FT   CDS_pept        428495..428890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0425"
FT                   /product="30S ribosomal protein S6, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67663"
FT                   /db_xref="GOA:C5BF77"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF77"
FT                   /protein_id="ACR67663.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYTGAITGAEGKIHRLEDWGRR
FT                   QLAYSINKLHKAHYVLMNVEASQEVIDELETNFRYNDAVIRSMVMRTKHAVTEASPMVK
FT                   AKDERRERREDFANETSEETEAGDSEE"
     atgcgtcatt acgaaatcgt ttttatggtt catcctgacc agagcgaaca agttccgggc        60
     atgatcgagc gttacactgg tgccatcact ggcgcagaag gcaagatcca ccgtctggaa       120
     gattggggtc gccgtcagct ggcttactca atcaacaaac tgcataaagc ccattacgtt       180
     ctgatgaacg ttgaagcttc gcaggaagtg atcgatgagc tggaaactaa cttccgctac       240
     aacgacgccg ttatccgcag catggttatg cgtactaagc acgctgtaac cgaagcttct       300
     ccgatggtta aagcgaaaga cgagcgccgt gagcgtcgcg aagatttcgc taatgaaacc       360
     agcgaagaaa ctgaagctgg ggattctgaa gagtaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page