(data stored in ACNUC7421 zone)

EMBL: CP001600.PE394

CP001600.PE394       Location/Qualifiers
FT   CDS_pept        429491..429940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0427"
FT                   /product="50S ribosomal protein L9, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67665"
FT                   /db_xref="GOA:C5BF79"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF79"
FT                   /protein_id="ACR67665.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPMGKAVPATKKNVE
FT                   FFEARRADLEAKLAETLSAAEARAVKINELATVTIASKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVAVTKSEVRLPNGVLRTLGDHEVHFQVHSDVFAQLNVVVVAE"
     atgcaagtta ttctgcttga taaggtagca aacctgggta gcctgggtga tcaggttaac        60
     gttaaagcag gttacgctcg taacttcctg gttccgatgg gcaaggctgt cccggcaacc       120
     aagaaaaacg tcgagttctt tgaagcacgt cgcgcagatc tggaagccaa actggctgaa       180
     accctgtctg ctgctgaagc acgtgctgtc aagatcaatg aactggccac cgttaccatc       240
     gcgtccaaag cgggcgacga aggtaaactg ttcggttcta tcggtacccg tgacatcgcc       300
     gatgcagtga ctgctgccgg cgttgcagtc acgaaaagcg aagttcgcct gccgaatggc       360
     gtgctgcgta ccctgggtga tcatgaagtt cacttccagg ttcacagcga cgtattcgca       420
     cagctgaacg tcgttgttgt tgctgagtaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page