(data stored in ACNUC7421 zone)

EMBL: CP001600.PE395

CP001600.PE395       Location/Qualifiers
FT   CDS_pept        430155..430523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0429"
FT                   /product="Protein of unknown function, DUF488"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67667"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF80"
FT                   /protein_id="ACR67667.1"
FT                   /translation="MVSIGLQRVYDVWAPCSPHTFLTDRLWPRGIAKARLDGVHWLKEV
FT                   APSTALRQAFHHAQLDWPAFVARYREELAANPRAWQSLVQLLCQGESLTLLYGSRDSQC
FT                   NQAVALRDWLLEQLIAGE"
     atggtatcga tcggtctgca gcgggtttat gacgtgtggg cgccctgttc tccccatacc        60
     tttcttaccg atcgcctgtg gccacgtggt atcgccaagg cgcgtctgga cggcgttcac       120
     tggctgaaag aggtcgcacc gtcgacggcc ctgcgtcagg catttcatca tgcgcagctg       180
     gactggcctg ctttcgtcgc gcgctatcgg gaggagctgg cggccaatcc ccgggcttgg       240
     cagtcgctgg tgcagttgtt gtgccaaggt gagtcgctga cgttgctgta tggcagtcgc       300
     gatagtcagt gtaatcaggc cgtagcacta cgtgactggt tgctggagca actcatcgca       360
     ggcgaataa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page