(data stored in ACNUC7421 zone)

EMBL: CP001600.PE396

CP001600.PE396       Location/Qualifiers
FT   CDS_pept        complement(430507..431154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0428"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67666"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF81"
FT                   /protein_id="ACR67666.1"
FT                   /translation="MGRIAPKKNKIPAYSGVAIQNIWRRLRRGLTALPAARPRKEDLRR
FT                   IPQQCRAALRALWHWPEQCDWMAPLPAFHRRWLTLICAVLLMALLWPIDDAAPPIQPPA
FT                   AHTEGSAIQATLQPQRATPISPDANDWQAYLILPGQTLAQVLREHNLDVTDAFAMARIE
FT                   GDDRPLSNLKAGQYVMIRHNPQGQILALKIETTDDRQVTFRRESDSSFIRLR"
     atgggcagaa ttgcgcccaa aaagaacaag atacccgcct atagcggcgt agctatccag        60
     aatatatggc gacgcctacg ccggggcctc accgccctgc ccgccgcgcg tccccggaaa       120
     gaggatctac gccgaatacc acagcagtgc cgggcggcgc tacgcgcgct ttggcactgg       180
     ccggagcaat gcgactggat ggcgccactg ccagcctttc accggcgctg gctcaccctc       240
     atctgcgccg tgctgctgat ggcgctactg tggcccatcg atgacgcggc cccgcccata       300
     cagcctcccg ctgctcatac ggagggttcg gcaatccagg ccacgctgca gccgcagcgc       360
     gcaacgccaa tctccccgga tgccaacgac tggcaagcct acctgatact gccgggacaa       420
     accctggccc aggtgctgcg agagcataat cttgacgtca ccgatgcctt tgccatggcg       480
     cggatcgaag gcgatgatcg cccgctgagc aacctcaagg cggggcagta cgtcatgatc       540
     cgacacaacc cccaggggca aattctcgcc ttgaaaatag agaccacgga cgatcggcag       600
     gtcaccttcc gcagggaaag cgacagcagc tttattcgcc tgcgatga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page