(data stored in ACNUC7421 zone)

EMBL: CP001600.PE398

CP001600.PE398       Location/Qualifiers
FT   CDS_pept        complement(432073..432738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0431"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67669"
FT                   /db_xref="GOA:C5BF83"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023742"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF83"
FT                   /protein_id="ACR67669.1"
FT                   /translation="MTYRDRPLGELAISIPRATRLFRQYELDFCCGGKLTLQRAAARHS
FT                   LDLVMLESQLAELDSTPDQHRDWRQAPLDELCAFIVTRYHQRHRDQLPELVLMAQKVEQ
FT                   VHTGKTGCPRGLAKQLDSLRQELDSHMMKEERILFPLIEQGEGARCHGPISVMEHEHRD
FT                   AGELLDVIRFLTDNMTPPTGACTTWRALYAGISELINDLMEHVSLENNLLFPRALGDV"
     atgacatacc gcgatcggcc gctcggtgag ctggccatta gcattccacg tgccactcgt        60
     ctatttcgcc agtacgaact ggatttttgc tgcggcggta agctgaccct acagcgcgcg       120
     gcggctcgcc attcgctgga tctggtcatg ctggaaagtc agctggccga gctggacagt       180
     actccggatc agcatcgaga ctggcggcag gcaccactgg acgagctctg cgcctttatt       240
     gtcacccgtt atcaccagcg ccatcgcgat cagctgcccg aactggtatt gatggcacag       300
     aaagtcgaac aggtacatac cggtaagact ggctgcccac gggggcttgc caaacagctc       360
     gattcgctac gccaagagtt ggacagtcat atgatgaagg aggagcgcat cctgtttccg       420
     ctgatcgaac agggagaggg agctcgatgc catgggccta tctcggtaat ggagcacgag       480
     catcgcgacg ctggagaact gctggacgtc atccgcttcc tgacagataa catgacgccg       540
     ccaacgggcg cctgtacaac ttggcgcgca ctgtatgccg gcattagcga actgattaac       600
     gatctcatgg agcacgtcag cctggaaaat aatctgctgt ttccgcgcgc gctcggcgat       660
     gtctga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page