(data stored in ACNUC7421 zone)

EMBL: CP001600.PE4

CP001600.PE4         Location/Qualifiers
FT   CDS_pept        3773..6187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0004"
FT                   /product="DNA gyrase, B subunit, putative"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67266"
FT                   /db_xref="GOA:C5BHC8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHC8"
FT                   /protein_id="ACR67266.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGYCKDIIVTIHSDNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRRDGHVHEQIYRHGVPAAPLKVVGDTDLT
FT                   GTRVRFWPSMETFSNVVEFQYDILAKRLRELSFLNSGVSIRLCDKRNDREDHFHYEGGI
FT                   KAFVEYLNKNKTPIHPNVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LAGFRAAMTRTLNSYMENEGYTKKSKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKSAVESLMNERLAEYLLENPSDAKIVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPAHSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQMSIALDGAALHINAAAPALA
FT                   GEPLEKLVAEYYQAQKLIGRMERRYPKAVLNQLIYQPTLSDADLGNQAQVEQWINSLVA
FT                   TLNEKELHGSVYSARALENRERQMFEPLVRVRTHGVDTDYGFDFDFVHGAEYRRICALG
FT                   EKLRDLLEESAFVERGERRQPVASFEQALDWLVKESRRGLAIQRYKGLGEMNPDQLWET
FT                   TMDPEGRRMLRVTIKDAVAADQLFTTLMGDAVEPRRAFIEENALKASNLDF"
     atgtcaaata cgtatgactc ctcaagtatc aaggtattaa aagggctgga tgccgttcgt        60
     aagcgcccgg gcatgtacat cggggatacc gatgatggta cgggtctgca ccacatggtg       120
     tttgaggtgg tggataacgc gattgacgaa gcgctcgctg gttattgcaa agatatcatc       180
     gtcaccattc acagtgacaa ctccgtctcc gtacaggatg acggccgcgg cattccaacc       240
     ggcattcacc cggaggaggg tgtctctgcc gccgaggtca tcatgaccgt gctgcacgcc       300
     gggggtaagt tcgacgataa ctcctataag gtctccggcg gcctgcatgg cgtgggggtt       360
     tccgtggtga acgccctgtc tgaaaagctg gagctggtga tccgtcgcga cggccatgtc       420
     catgagcaaa tctaccggca cggggtaccg gcagcaccgc tgaaagtggt tggcgacacc       480
     gatctgaccg gtacccgtgt gcgtttctgg ccgagtatgg agaccttcag caatgtggtt       540
     gagttccagt atgacatcct ggccaagcgc ctgcgtgaac tctccttcct gaactccggc       600
     gtctccattc gtctgtgcga caaacgcaac gatcgcgaag atcatttcca ctatgagggt       660
     gggatcaagg cgtttgttga gtatctgaac aagaacaaaa cgccaatcca tccgaacgtg       720
     ttttactttt cgaccatgaa ggatgatatc ggcgtagagg tggcactgca gtggaacgat       780
     ggcttccagg aaaatatcta ctgctttacc aataacatcc cgcagcgcga tggcgggacc       840
     catctggccg gtttccgtgc ggcgatgacc cgtacgctga acagctacat ggagaacgag       900
     ggctatacca agaagagcaa aatctccgct accggcgacg atgcgcgtga ggggctgatt       960
     gccgtggtat ccgtgaaggt accggatccc aagttctcct ctcagaccaa ggataagctg      1020
     gtctcttctg aggtgaaatc cgccgttgag tcgctgatga acgagcgtct ggctgaatac      1080
     ctgctggaaa atcccagcga tgccaaaatt gtcgtgggca aaatcatcga cgcggcccgc      1140
     gcacgcgagg cagctcgcaa ggcgcgtgaa atgacccgcc gcaagggcgc gctggatctg      1200
     gccggcctgc cgggcaagct ggcggactgc caggagcgcg atcccgccca ctcagagctc      1260
     tacctggtgg aaggggactc cgcgggcggc tctgccaagc agggacgtaa ccgtaagaat      1320
     caggcgatcc tgccactgaa ggggaaaatc ctcaacgtgg agaaggcgcg cttcgataag      1380
     atgctctcct cgcaggaggt cgcgaccctg atcaccgcac tgggctgcgg cattggccgg      1440
     gatgagtaca acccggataa gctgcgttat cacagcatca tcatcatgac cgatgccgac      1500
     gtcgatggct cgcacatccg taccctgttg ctgaccttct tctatcgcca gatgccggaa      1560
     attatcgagc gcggtcatgt atatattgct cagccgccgc tgtacaaggt gaagaaaggt      1620
     aagcaggaac agtacattaa agacgatgag gcgatggatc agtatcagat gtccatcgca      1680
     ctggacggcg ccgccctgca tatcaatgcc gccgcccccg cgctggccgg tgagccgctg      1740
     gaaaaactgg tggcggaata ttaccaggcg cagaagctga ttggtcgcat ggagcgtcgc      1800
     tatcccaaag cggtgctgaa ccagctgatc tatcagccga ccctcagcga cgccgatctg      1860
     gggaaccagg cgcaggttga gcagtggatt aactcactgg tggcaacgct gaacgagaaa      1920
     gagctgcacg gtagcgtcta tagcgcccgc gctctggaga atcgcgaacg tcagatgttc      1980
     gagccactgg tgcgtgtgcg tacccacggt gtggataccg actatgggtt tgactttgat      2040
     tttgttcacg gcgccgagta tcgccgtatc tgcgcgctgg gtgaaaagct gcgagatctg      2100
     ctggaagaga gcgccttcgt ggagcgcggc gaacgtcgtc agccggtggc cagctttgag      2160
     caggcgctgg actggctggt gaaggagtcg cgtcgtggcc tggccattca gcgttacaaa      2220
     gggctgggtg aaatgaaccc ggatcagctg tgggaaacca ccatggatcc ggaagggcgc      2280
     cgtatgttgc gtgtgaccat taaggatgcg gtggcagccg atcagctgtt caccaccctg      2340
     atgggggatg cggttgagcc gcgtcgggcc tttatcgaag agaatgcgct gaaggcctcc      2400
     aacctagact tctaa                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page