(data stored in ACNUC7421 zone)

EMBL: CP001600.PE40

CP001600.PE40        Location/Qualifiers
FT   CDS_pept        35203..35634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0042"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67302"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C2"
FT                   /protein_id="ACR67302.1"
FT                   /translation="MAEINKATLTEADIISKYLLPAIKAAGWDDLTQIRQEVKLRDGKV
FT                   VVRGQMAARKKVKSADIVLYHKMGLPLAVIEAKANKHEIGKGMQQGLDYARLLDVPFVF
FT                   SSNGDGFVFHDKTNPATLESEIALEDFPSPGQLWDKLCT"
     atggccgaga tcaacaaagc gaccctcacc gaagccgaca tcatctccaa atacctgctg        60
     cctgccatca aggcggcggg gtgggatgac ctgacccaga tccgccagga agtgaagctg       120
     cgggatggca aagtggtagt gcgcggccag atggcggcac gcaaaaaggt gaaatcggcc       180
     gatatcgtgc tctaccacaa gatgggcttg ccactggcgg tgatcgaggc caaagccaac       240
     aagcatgaga ttggcaaggg aatgcaacag gggctcgatt atgcccgcct gctggatgtg       300
     ccgttcgtat tttccagcaa cggcgatggc ttcgtttttc atgacaagac caatccggcc       360
     acgctggagt ccgagattgc gctggaggat ttccccagcc cgggccagct ctgggacaag       420
     ctctgtacct ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page