(data stored in ACNUC7421 zone)

EMBL: CP001600.PE403

CP001600.PE403       Location/Qualifiers
FT   CDS_pept        complement(435912..436550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0436"
FT                   /product="Peptide methionine-S-oxide reductase, putative"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67674"
FT                   /db_xref="GOA:C5BF88"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF88"
FT                   /protein_id="ACR67674.1"
FT                   /translation="MHHHNSSTPAPFTPAQALPGRTQAMSLSGKHALNGHDMYAIPAGM
FT                   EEALFAMGCFWGVERLFWQQPGIYSTAAGYSGGLTPNPTYREVCSGQTGHAETVRVVFD
FT                   PSLIRYDDLLRLFWQHHDPAQGMRQGNDVGTQYRSALFPVTSQQMQAAQASHTRFAQAM
FT                   HQVGDLRPISTEIRAAGPFYYAEEEHQQYLHKHPHGYCGVGGIGVCLPD"
     ttgcaccatc acaacagcag tacccctgca ccgttcacgc ctgcacaggc actgcctggg        60
     cgcacacagg ccatgagtct ctccggcaaa catgcgctta acggccacga tatgtatgcc       120
     attcctgccg ggatggagga ggccctgttc gccatgggct gcttctgggg tgtcgagcgc       180
     ctgttctggc agcagccggg gatctacagc actgcggctg gctacagcgg cggtctgacc       240
     cccaacccaa cctatcgcga agtgtgcagc ggtcagaccg ggcacgccga aacggtacgg       300
     gtggtgtttg atccctccct tatccgctat gacgatctgc tgcgcctgtt ctggcagcac       360
     cacgatccgg cgcaggggat gcgtcagggc aacgatgtcg gcacccagta tcgctctgcg       420
     ttgttccccg tgacgtccca gcagatgcag gccgcacaag ccagccatac ccgttttgct       480
     caggctatgc atcaggtcgg cgacctgcgc ccgatcagca cagagatccg cgccgccggg       540
     ccattttact atgctgaaga ggagcaccag cagtacctgc acaaacaccc gcacggttac       600
     tgtggggtgg gcgggatcgg cgtctgcctg ccagattaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page