(data stored in ACNUC7421 zone)

EMBL: CP001600.PE404

CP001600.PE404       Location/Qualifiers
FT   CDS_pept        436833..438569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0437"
FT                   /product="outer membrane protein, OMP85 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67675"
FT                   /db_xref="GOA:C5BF89"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF89"
FT                   /protein_id="ACR67675.1"
FT                   /translation="MPRLRRIGLLCLLLAAPLAHAAQVRLVVEGLSGQLQQNVRATLST
FT                   IGEDEISNDGRFRVRAADAIRQGLRALGYFQPTIEFEYRPGSIFSRPQLIANVTPGEPV
FT                   RIAGLNVRIRGAAKDDSAYQALLAKSLPPVGSVLDQGDYDNLKNALNSLALQRGYFSAT
FT                   MPVHQLGVIEDQHKAFWDIEFDSGPRYRFGDVRFSGSQIQTAYLQNLRPFKSGEYYSAD
FT                   DLAKFSGNLSATNWFNSVVVSPDFKALGTDQTLPLQAVVTPRSQNMVDLGGGYATDVGP
FT                   RMKVSWKRPWMNSYGHSLDTSLNLSMPEQTADFSYKIPLLKAPLEQYYLVQGGFQRTDL
FT                   NDTQSDSTTLNLARYWELSSGWQRGINMRWGLDHFTQGNVTETAMLLYPGVSVNRTRSR
FT                   GGLMPSWGDTQRYSMDVSNRYWGSSVDFVVFQAQNVWIRTLAERHRFVVRGDLGWIETN
FT                   DFNKVPPSLRFFAGGDRSIRGYKYKSISPKGSDGKLTGASRLATGSLEYQYNLSGKWWG
FT                   GVFIDSGEAVNDFTKSDFHTGTGVGVIWVSPVGPIRLNLGVPVGREDKHDVQIYIGLGP
FT                   EL"
     atgccacgat tgcgtaggat aggcctgctg tgtctgttat tagcggcgcc gctggcgcat        60
     gccgctcagg tcagattggt ggtagagggg ttgagcggac agctgcagca gaatgtgcgt       120
     gccacgttgt cgaccatcgg cgaagatgag atcagtaacg atggccgttt tcgcgtgcgt       180
     gcggcggatg ccattcgtca ggggctgagg gcgctgggct attttcagcc gaccattgaa       240
     tttgagtatc ggcccggatc gatcttttcc cgtccacagc taatcgctaa cgtcacgccc       300
     ggtgagccgg tgcgtattgc cggactcaat gtgcgtatcc gcggggcggc taaggatgac       360
     tccgcctatc aggcgctgtt ggccaagtct ctgccgccgg tcggcagtgt gctcgatcag       420
     ggcgactatg acaatctgaa aaatgccttg aactcgctgg cgctgcagcg gggctatttt       480
     agtgccacca tgccggtgca tcagctcggg gttatcgagg atcagcacaa ggcattctgg       540
     gatatcgaat ttgatagcgg gcctcgctat cgctttggtg atgtacggtt cagcggctcg       600
     cagatccaga ccgcctattt acagaatcta cgcccgttta agtccgggga gtattacagc       660
     gctgatgacc tggccaagtt cagcggtaac ctgtcggcga ccaactggtt taactcggtg       720
     gtggtgtcgc ccgattttaa ggcgctgggg acggatcaga cgctgccgct tcaggccgtg       780
     gtgacgccgc gcagccagaa tatggtcgat ctggggggcg gatacgcgac ggacgtcggc       840
     ccgcggatga aggtcagctg gaagcgtccc tggatgaact cctatggcca cagtctggat       900
     acctcgctga atctctccat gccggagcag acggcagact ttagctataa aattccgctg       960
     ctgaaggctc cgctggagca gtactatctg gtacagggcg gttttcagcg aaccgatctg      1020
     aacgacaccc agtccgactc tactaccctg aatctggcgc gttactggga actctccagc      1080
     ggctggcagc gtggcatcaa tatgcgctgg ggtctcgatc actttacgca gggcaatgtc      1140
     accgagactg ccatgctgct gtatcccggc gttagcgtaa accgtacgcg ctcgcgcggc      1200
     gggctgatgc cgagctgggg ggatacgcag cgctattcaa tggatgtgtc caaccgttat      1260
     tgggggtcat cggtcgactt tgtggtgttt caggcgcaaa acgtctggat acgcacgctg      1320
     gcggagcgac atcgtttcgt ggtgcgtggc gatcttggct ggatagaaac caatgatttc      1380
     aataaggtgc ctccatccct gcgcttcttt gccgggggcg atcgcagtat ccgcggctat      1440
     aaatataaat cgatctcgcc caagggcagc gatggtaagc tgaccggtgc ctcgcgcctg      1500
     gcgaccggct ctctggagta ccagtacaac ctgagtggca agtggtgggg gggggttttt      1560
     atcgactcag gtgaggccgt gaacgatttt accaagagtg actttcacac cgggaccggc      1620
     gtaggggtta tctgggtgtc gccggtcggc cccatccggc ttaaccttgg cgtgccggta      1680
     gggcgtgaag ataagcacga tgtgcagatt tatattggat tagggcctga gctatga         1737
//

If you have problems or comments...

PBIL Back to PBIL home page