(data stored in ACNUC7421 zone)

EMBL: CP001600.PE405

CP001600.PE405       Location/Qualifiers
FT   CDS_pept        438566..442330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0438"
FT                   /product="Protein of unknown function (DUF490)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67676"
FT                   /db_xref="GOA:C5BF90"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF90"
FT                   /protein_id="ACR67676.1"
FT                   /translation="MRWYNIRRYALMLLLGLLLLLALLLGGVMTQGGLHLALNAAARWV
FT                   PGLEIGRVEGGWRDLTLRDVGYRMPGVDVAVGQFHLSLDIGCLKRSELCLNVLSAQRVR
FT                   VNVDTQALPPSEPPTTPSAPLGRLATPYPLVLRLLRLNDVQVNVDGTAISLEALRSGAE
FT                   WRGSLLRLQPSDIQGLRVSLPPPAAPAPAESAAPKGPSEPLGEVLTALFSRPLLPAAMT
FT                   LDLPLDMQLSRISARQVQIRAATDLDIASLELRAALDQQRLALHTLKVQAQQGSLSARG
FT                   SATFSGRWPLDLQLNASVNQAPLKGEKLRLALKGAMYDTLALDANLSGPLRATLKGDTR
FT                   LADAGLPLSLSLDSPSLRWPLGGTPDYQVNNMVLRLTGSAHDYRLQLRGAFSGQGLPDA
FT                   ALDLAGKGNERQFTLSQLQLATLGGKADMQALVDWSKAISWRSSLTLTGIDTGRQWPAW
FT                   PSSLNGKIETRGSLYGGSWQLQVPQLKLTGRIKQNGLDVGGQLRGNQAGQWQIPQLHIA
FT                   LGRNRIEVNGDLAQKQWSLDGRIDAPRLDGTLPGLSGSARGTLKLRGDRQAPQLLADLQ
FT                   ARGLRWQDLTIQRVALLGDIRSDQQIQGTLDLRVDSLKQGDIDISQLTLRAAGNERQHR
FT                   LQLVMQGTPLAGRLTLNGSLAQDRARWSGTLTDTDFTTPVGEWRLTRPIALEYGVAKQQ
FT                   MAIGPHCWDNPNARLCVPQTIEVGESGKVSVVLERFDLAMLQPFLGPDTQLHGRFSGRA
FT                   QASWQAGQGLPQARITLNGDGVRVVQQVQGNTLPVALSTVTLEASLAQGQARVNWLIGI
FT                   VDNGQLRGDVRIANLEGARNLSGNVDIQHLSLALFNPALMKGEKAQGMLNASLRLGGST
FT                   LHPQLYGRLALDGVDIDGQFMPFDVTDANLAINFDGMSSVLQGVIKTSQGQLNLSGNAD
FT                   WRNLNAWRARIAASGTRLRVTVPPMVRLDVSPNIVFDASPSQLALSGWVDIPWARITVQ
FT                   ELPESAVGVSSDEVMLNNAHQPIRPVTASIPLHTDLTIAIGNNVRLSAFGLKAALKGEL
FT                   KVSQNQNGLGLNGQIMIPQGRFAAYGQDLLIRQGELVFAGPPGNPLLNIEAIRNPESTA
FT                   NDVTVGVRVTGLAEQPKLEVFSDPAMSQQEALSYLLRGQGLNSSGADSNAMTSMLIGLG
FT                   VAQSGKLVGKIGETFGVSNLTLDSQGVGDSSQVVVSGYVLPGLQVKYGMGIFDSLATLT
FT                   LRYRLMPNLYLEAVSGVNQALDLLYQFEF"
     atgaggtggt ataacatccg gcgctatgcg ctgatgcttc tgctggggct gttgctgctg        60
     ctggcgctgt tgctgggggg ggtgatgacc caaggcgggc tgcatctggc actcaatgct       120
     gctgcccgct gggttccggg gctggaaatt ggccgggtgg aggggggatg gcgcgatctt       180
     accctgcgcg atgtcggcta ccggatgccc ggtgttgatg tcgccgtagg gcagtttcat       240
     ctctctttgg atatcggctg tctgaagcgc agcgagttgt gtctgaatgt gctgagcgcc       300
     cagcgggtgc gggtgaatgt cgatacccag gcgctgccgc ccagtgaacc accgacgacg       360
     ccatcagccc cattggggcg cttggctacc ccctatcctt tggtgctgcg tctgttgcgt       420
     cttaatgacg tacaggtgaa tgtggacggt actgcgattt ccctggaggc cctgcggagc       480
     ggagcagagt ggcgcggatc gctgctgcgc ttacagccca gcgatattca ggggctgcgg       540
     gtgtcgctgc ctccgccggc tgcgcctgcg ccagcggaga gcgccgcgcc gaagggccca       600
     tccgagccgc tgggagaggt gctgacggcg ctgttttccc ggccgctgct gccggcggcg       660
     atgacgctgg atctgccact ggatatgcag ttgagccgca tttccgcgcg tcaggtgcag       720
     atccgggcgg cgaccgatct ggatatcgcg tctcttgaac tgcgcgcggc gttggatcaa       780
     cagcgcctgg cgctgcatac cctgaaggtc caggcgcagc aggggagcct gtcggcgcgc       840
     ggcagtgcga cgttcagcgg ccgctggccg ttggatctgc agctgaatgc cagcgtgaat       900
     caggcgccgc tgaagggcga aaagctgcgc ctggcgctga agggggcgat gtacgatacg       960
     ctggctctcg atgccaacct gtccggtccg ctgagggcga ccctgaaggg ggatacccgc      1020
     ctggccgacg ccggtctgcc gctgtcgctg tcgctggaca gccccagcct gcggtggccg      1080
     ctggggggaa cgcccgacta tcaggtgaac aatatggtgc tgcgtctgac ggggagcgcc      1140
     catgattatc ggctgcagct gcgcggcgcg ttcagtggtc aggggctgcc ggatgcggcg      1200
     ctggacctcg cgggaaaggg gaacgaacgt cagtttaccc tgagtcagct gcagttggcg      1260
     acgttgggcg gcaaggccga tatgcaggca ctggtcgact ggagcaaagc gataagctgg      1320
     cgcagcagcc tgacgctgac ggggatcgat accggacgtc agtggccggc gtggccgtcg      1380
     agcctgaacg gtaaaatcga gacccgcggt agtctgtatg gcggtagttg gcagctgcag      1440
     gtgccacagc tgaagctgac ggggagaatc aaacagaatg ggttggatgt cggcggtcag      1500
     ctgcgtggca atcaggcagg acagtggcag atcccccagc tgcacatcgc gctggggcgt      1560
     aaccggattg aggtgaacgg cgatctggcg cagaagcaat ggtctctgga cgggcgtatt      1620
     gatgccccgc gcctggatgg gacgctgccg gggctgtcgg ggagcgcgcg cgggacgctg      1680
     aagctgcgcg gtgatcgtca ggcaccccag ctgctggccg atctgcaggc ccgcgggctg      1740
     cgttggcagg acttaaccat ccagcgagtc gcgctgctgg gggatatccg ctcggatcaa      1800
     cagattcagg ggacgctgga tctgcgtgtg gatagcctaa agcaaggcga tattgatatc      1860
     agccaactga ccttgcgtgc cgccggtaat gaacggcagc atcggctgca gctggtgatg      1920
     caggggacgc cgctggctgg ccgtttgacc ctcaacggta gtttggcgca ggatcgggcg      1980
     cgctggagtg gcacgctgac ggataccgac tttacgacgc cggtcggcga gtggcgcctt      2040
     acccgaccca tcgcgctgga gtatggcgtc gccaaacagc agatggccat tggcccccac      2100
     tgctgggata accccaatgc acgtctgtgc gttccgcaga ccatcgaggt gggcgagagc      2160
     ggcaaggtca gcgtggtgct ggagcgattt gatctggcga tgttgcagcc gtttcttggg      2220
     ccggataccc agttgcatgg gcgcttcagt gggcgggctc aggccagctg gcaggcggga      2280
     caaggactgc cacaggcgcg gattacgctc aacggtgatg gcgttagggt agtgcaacag      2340
     gtacagggaa atacgctgcc ggtggccctg agcacggtca cactggaggc gagcctggcc      2400
     caggggcaag ctcgcgttaa ctggctgatc ggcatcgtgg acaacggtca gctgcgcggc      2460
     gacgtgcgca tcgcaaacct ggagggggcg cgtaatctct ccggtaatgt agatatccag      2520
     cacctttcgc tggcgctgtt caatccggcg ctgatgaaag gggagaaggc acagggaatg      2580
     ctcaatgcgt cgctgcgcct gggcggcagt acgctgcatc cgcagctgta tggccgcctg      2640
     gcgctggatg gcgtggacat cgacggacag ttcatgccat tcgatgtcac tgatgcaaac      2700
     ctcgcgatca actttgacgg tatgagctcg gtgctgcagg gggtgattaa gacctcgcag      2760
     ggacagctga atctatccgg taatgcggac tggcgtaatc tgaatgcctg gcgcgcccgc      2820
     attgccgcca gcggtacgcg cctgcgggtg acggtgccgc cgatggtccg gttggatgta      2880
     tcgccgaata ttgtattcga tgcctcccca agtcagttgg cgctgagcgg atgggtcgat      2940
     attccctggg cgcgtatcac ggtgcaggag ctgccggaga gtgcggtcgg cgtatcctcc      3000
     gatgaggtga tgctgaacaa tgcgcatcag ccgatcaggc cagtcaccgc ctcgatcccg      3060
     ttgcataccg atctaaccat tgctattggc aacaacgttc gcctctccgc ttttggcctc      3120
     aaggcagcgc taaaaggtga actgaaggtg agccagaacc agaatggcct tggattgaat      3180
     ggccagatca tgatcccgca ggggcgcttt gccgcgtatg gacaagattt gttgattcgc      3240
     cagggtgagt tggtatttgc cgggccgcca gggaatccgc tgctgaatat tgaagcgata      3300
     cgcaatccag agtcgacggc gaacgatgtt acggtgggtg tccgcgttac aggacttgcc      3360
     gagcagccga aactggaagt attctcagat ccggcaatgt cacaacaaga agctctctcc      3420
     tacctattgc gcggtcaagg gctgaacagc agcggcgcag acagtaatgc gatgacgtcg      3480
     atgttgatag gtctgggtgt tgcgcagagt ggtaaactgg taggaaaaat cggcgaaacc      3540
     tttggagtca gcaacctgac tctggattcg cagggggtgg gtgacagttc tcaggtggta      3600
     gtcagcggct atgtcttgcc ggggctgcag gtaaagtatg gcatggggat cttcgattcg      3660
     ctggccacgc tgacgctgcg ttaccgtctg atgccgaatc tgtatctgga agcggtgtct      3720
     ggcgtaaatc aggcacttga tctgctctat cagtttgagt tttaa                      3765
//

If you have problems or comments...

PBIL Back to PBIL home page