(data stored in ACNUC7421 zone)

EMBL: CP001600.PE406

CP001600.PE406       Location/Qualifiers
FT   CDS_pept        442387..442677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0439"
FT                   /product="AIG2-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67677"
FT                   /db_xref="GOA:C5BF91"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF91"
FT                   /protein_id="ACR67677.1"
FT                   /translation="MTNATWLGDYVLDGYDLYDLGHYPAVVPGEGRVYCEVYRITSSIL
FT                   AELDELKSNSKDYRRELIKTPYGCAWIYIYLNGVEGLPRIASGDWLKREEG"
     atgaccaatg ccacctggct gggcgattat gtgctggatg gctacgatct gtacgatctt        60
     ggccattatc cagcggtggt tccgggagag ggaagggttt attgcgaagt gtaccggatt       120
     acctcgtcga tcctggcgga gctggatgag ctaaagagta acagcaagga ttatcgtcgc       180
     gaactgatta aaacgcccta tggctgtgcc tggatctaca tctatctcaa tggggtcgag       240
     gggttgccac gcattgccag cggagactgg ctaaagcgag aggaaggctg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page