(data stored in ACNUC7421 zone)

EMBL: CP001600.PE41

CP001600.PE41        Location/Qualifiers
FT   CDS_pept        35773..37653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0043"
FT                   /product="type III restriction enzyme, res subunit,
FT                   premature stop"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67303"
FT                   /db_xref="GOA:C5B9C3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C3"
FT                   /protein_id="ACR67303.1"
FT                   /translation="MLVMATGTGKTYTAFQIIWRLWKAGAKKRILFLADRNILVDQAKI
FT                   NDFQPFGPAMTKVSGRTIDPAYEIHLALYQALTGPEESQKAFKQVSPDFFDLIVVDECH
FT                   RGSAAEDSAWREILEYFSSATQIGLTATPKETETVSSTDYFGDPVYTYSLKEGIEDGFL
FT                   APYKVVRVDIDVDLQGWRPTKGQRDKQGNLIEDRIYNQKDFDHTLVIDERTQLVAETIT
FT                   NYLRKTDPMAKTIVFCNDIDHADRMRRALVNLNPEQMAKDERYVMKITGDDDLGKAQLD
FT                   NFINPKKPYPVIATTSELMTTGVDAKTCKLVVLDQNIQSMTKFKQIIGRGTRIDDKYGK
FT                   LWFTILDFKKATELFADPRFDGEPERVMVVTPADINNPDDGLGDIIDGADPLPADESGD
FT                   HGDPFAPGVDEQPGSYTTVNGAGGQGTGPLGGPEPGVSRYYVNGVAVSVIAERVQYYDA
FT                   DGKLVTESFKDYTKKTLLKEFATLDAFTKRWQGAERKQAIMDELAQAGVLWEVLEQEVG
FT                   KELDPFDLICHVVYDQPPLTRRERANNVKKRNYFTKYNDTAQQVLTSLLDKYADQGVTE
FT                   IETKDALKVAPFTELGRPLELAKKGFGGPKQFEQAITELEQEIYREQQSA"
     ttgctggtaa tggccaccgg caccggcaag acctacaccg cgtttcagat catctggcgt        60
     ttgtggaagg cgggcgccaa aaaacgcatc ctgtttctgg ccgatcgcaa cattttggta       120
     gatcaggcca agatcaatga ctttcagccc tttggcccgg ccatgaccaa ggtcagtgga       180
     cgcactatcg atcctgccta cgagatccat cttgctctct atcaggcgct caccgggccg       240
     gaagagtcac agaaagcctt taagcaggtc tcacccgact tcttcgacct gattgtggtg       300
     gacgagtgcc accggggcag cgccgccgaa gacagcgcct ggcgcgagat cctcgaatac       360
     ttctcatcgg ccacccagat tggtctcacc gccacgccca aagagaccga aactgtctcc       420
     agcaccgatt acttcggtga cccggtttat acctactccc tgaaagaggg gatcgaagat       480
     ggttttcttg ccccctacaa ggtggtacgg gttgatatcg acgtcgatct gcaggggtgg       540
     cgccctacca aagggcagcg ggacaaacag ggcaacctga ttgaagatcg tatctataac       600
     cagaaggatt tcgaccacac tctggtgatc gacgagcgta cccagctggt ggccgagacc       660
     atcaccaact acctcaggaa aaccgacccg atggccaaga ccatcgtctt ctgcaacgac       720
     atcgatcatg ccgaccgcat gcgacgggcg ctggtcaacc tcaacccgga acagatggcc       780
     aaggacgaac gctatgtgat gaaaatcacc ggcgatgacg atcttggcaa ggcccagctc       840
     gacaacttca tcaacccgaa aaagccctat ccggtgattg ccaccacctc cgagctgatg       900
     accaccggcg tcgatgccaa gacctgcaag ctggtggtgc tggaccaaaa catccagtcc       960
     atgaccaagt tcaagcagat catcggccgt ggcacccgca tcgacgacaa atacggcaag      1020
     ctctggttta ccattctcga cttcaagaag gccaccgagc tgtttgccga tccccgtttc      1080
     gacggtgagc cggagcgcgt catggtggtc acaccggcag acatcaacaa cccggatgat      1140
     ggtctgggcg atatcatcga tggcgccgat ccactgcctg ccgatgaatc cggcgaccat      1200
     ggcgatccgt ttgcccccgg agtcgatgaa caacccggca gctacacaac cgtgaatggc      1260
     gcgggggggc agggcacagg cccgctgggt ggccccgagc ccggggtcag caggtattat      1320
     gtcaacggcg tggcggtcag cgtcatcgcc gagcgggtgc agtattacga tgccgatggc      1380
     aagctggtga ccgaatcctt caaggactac accaagaaga ccctgctcaa agagtttgcc      1440
     accctcgatg ccttcaccaa acgctggcaa ggggccgagc gcaagcaagc tatcatggat      1500
     gaattggctc aggcgggcgt gctgtgggag gtgttggagc aggaagtggg taaggagctc      1560
     gacccgttcg accttatctg ccatgtggta tacgatcagc caccgctgac ccgccgcgag      1620
     cgggccaaca acgtcaaaaa gcgcaactat ttcaccaagt acaacgacac cgcccagcag      1680
     gtgcttacca gcctgctcga caaatatgcc gatcaggggg tgaccgagat tgagaccaag      1740
     gatgcgctaa aagtcgcccc ctttaccgag ttggggcgcc cgctggagtt ggccaagaag      1800
     ggttttggtg gccccaaaca gttcgagcag gccatcaccg aactggagca agaaatttac      1860
     cgtgagcagc agagcgcctg a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page