(data stored in ACNUC7421 zone)

EMBL: CP001600.PE414

CP001600.PE414       Location/Qualifiers
FT   CDS_pept        complement(448609..448893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0447"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67685"
FT                   /db_xref="GOA:C5BF99"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF99"
FT                   /protein_id="ACR67685.1"
FT                   /translation="MKKTLPEDWHPAEIIAALHKRRLTLTQVSRNAGLSSSTLANALTR
FT                   PWPKGEWLIAEALSIHPSEIWPSRYYDPITHELLDRKRLIRNVASVKKG"
     atgaaaaaaa cgctcccgga agactggcac ccggcagaga tcattgccgc attgcacaag        60
     cgcaggctga cgctcaccca ggtatcacgt aacgccggtc tatccagctc gacgctagcc       120
     aatgctctga ctcgcccttg gcccaaaggt gaatggctga tcgccgaggc gctgagtatc       180
     catcccagcg agatctggcc cagccgttac tacgacccca tcacccatga gctgctggat       240
     cgcaagcggc tgatccgtaa cgtcgcctcg gtcaaaaagg gctga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page