(data stored in ACNUC7421 zone)

EMBL: CP001600.PE416

CP001600.PE416       Location/Qualifiers
FT   CDS_pept        450319..450630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0449"
FT                   /product="50S ribosomal protein L21, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67687"
FT                   /db_xref="GOA:C5BFA1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA1"
FT                   /protein_id="ACR67687.2"
FT                   /translation="MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFDQILMVANGE
FT                   DIKIGVPFVAGGKIKAEVVAHGRGEKVKIVKFRRRKHHRKQQGHRQWFTDVKITGISA"
     atgtacgcgg ttttccaaag tggtggtaaa caacaccgag taagcgaagg tcagaccgtt        60
     cgcttggaaa agctggacat cgcaactggt gagactgttg agtttgacca gattctgatg       120
     gtcgctaacg gcgaagacat caagattggc gttccttttg tagctggcgg taaaattaag       180
     gctgaagttg ttgctcacgg tcgtggcgag aaagtgaaga tcgtcaagtt ccgtcgtcgt       240
     aagcatcatc gtaaacagca gggtcatcgt cagtggttca ctgacgtgaa gatcactggt       300
     atcagcgctt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page