(data stored in ACNUC7421 zone)

EMBL: CP001600.PE417

CP001600.PE417       Location/Qualifiers
FT   CDS_pept        450649..450906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0450"
FT                   /product="50S ribosomal protein L27, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67688"
FT                   /db_xref="GOA:C5BFA2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFA2"
FT                   /protein_id="ACR67688.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGCGRDHTLFALADGKVKFEVKGPKNRKFISIVAE"
     atggcacata aaaaggctgg cggctccagt cgcaacggtc gcgattccga aagcaaacgt        60
     ctgggcgtaa aacgcttcgg cggcgaatca gttctggcag gcagcatcat cgttcgtcag       120
     cgcggtacta agttccacgc tggtagcaat gtaggttgcg gtcgtgacca cactctgttc       180
     gctttggctg acggtaaagt taagttcgaa gttaaaggcc cgaaaaaccg taaatttatc       240
     agcatcgttg ctgagtaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page