(data stored in ACNUC7421 zone)

EMBL: CP001600.PE418

CP001600.PE418       Location/Qualifiers
FT   CDS_pept        450988..451929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0451"
FT                   /product="Integral membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67689"
FT                   /db_xref="GOA:C5BFA3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA3"
FT                   /protein_id="ACR67689.1"
FT                   /translation="MSMESKQSAALGIALALTTAIFWGALPIAIKQLLPDMAPETIVWY
FT                   RFSMAALGLGSVLCLRGQLPPLRVFRQRRWLLLLSVATVGLLGNFILFSTSLQYLSPTT
FT                   SQVIGQLSPVGLMFASVLVLKERMRPAQVIGAALLIGGLLLFFNTSLAEIFTRLTDYTL
FT                   GVLLGVAAAGVWVCYGIGQKVLLRRLASQQILCLLYALCAICLWPLAQPGQIYQLSGWQ
FT                   LLCLLFCGINTLVGYGALAEAMVRWQVAKVGAIVTLTPLFTLMFSDILALAWPETFMTP
FT                   SLNVVGYIGAFVVVAGAMFSATGHRWWPRQRT"
     atgtccatgg agagtaaaca gagtgcagct ctgggcatcg cgctggcgct gacgacggcg        60
     attttctggg gcgcactgcc gatcgcgatt aagcagctcc tgcctgacat ggcgcctgag       120
     accatagttt ggtaccgttt ctctatggcg gcattagggc tgggcagtgt gctgtgcctg       180
     cgtggccaac tgccgccgct gcgcgtattt cgacagcggc gttggttact gttgctgtcc       240
     gttgctacgg tggggctact ggggaacttt atcctgttca gcacctcgct acagtatttg       300
     agtccaacca cctcacaagt gatcggacag ctttcgccgg tcggtctgat gttcgccagc       360
     gtactggtac tgaaagagcg gatgcggcca gcgcaggtga ttggcgctgc gctgctgatc       420
     ggtggactgc tcctgttttt taataccagc ctggcggaga tttttacccg tctaacggac       480
     tacacgctgg gtgtgttact cggggtggcg gcggccgggg tttgggtatg ctatggcatc       540
     ggccagaaag tattattgcg tcgcctggcc tcgcagcaga tcctttgtct gttgtatgct       600
     ttatgtgcga tctgcctgtg gccgttagca caaccgggcc agatttatca gctgagtggc       660
     tggcagctac tgtgcctgct gttctgcggg attaatacgc tggtcggtta cggtgcgctg       720
     gccgaggcca tggtgcgctg gcaggtggcg aaagtggggg ctattgtgac gctgaccccg       780
     ctgtttacac tgatgttttc tgacatttta gcgttagcct ggccggaaac ctttatgacg       840
     cccagcctga atgtggtggg gtatatcggc gcttttgtgg tggttgccgg cgccatgttt       900
     tctgcgactg gccaccgttg gtggccgcgc cagcgcacat aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page