(data stored in ACNUC7421 zone)

EMBL: CP001600.PE419

CP001600.PE419       Location/Qualifiers
FT   CDS_pept        451978..453156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0452"
FT                   /product="GTP-binding protein Obg/CgtA , putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67690"
FT                   /db_xref="GOA:C5BFA4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA4"
FT                   /protein_id="ACR67690.1"
FT                   /translation="MKFVDEAVIHIEAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGQDVTIKVPVGTRITDVDTGEV
FT                   LGDMTRHQQKLMVGKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDKRDLSLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDSEKSFVVADIPGLIEGAS
FT                   EGAGLGIRFLRHLERCRVLLHLIDLAPIDESDPVENARVIIGELEKYSEKLFQKPRWLV
FT                   FNKADLLAPEEAKARAQAIADALGWEGEHYLISAANREGVNALCWDVMNFLEAHPREAE
FT                   VEEEKEKAKKAEFMWDDYHREQLEQAEAEWEEEDDDDWDEDDDEGVEIIYQR"
     atgaaatttg tagatgaagc cgtgatccac atcgaagcag gtgatggtgg caatggctgc        60
     gtcagcttcc gccgcgaaaa gtatatccct aaagggggac cggacggcgg tgacggcggt       120
     gacggcggtg atgtatacct gctggctgat gagaacctga acacgctgat cgactatcgt       180
     tttgagaagt cttttcgcgc cgaacgtggc cagaacggcc agagccgtga ctgcaccggt       240
     aaacgtggcc aggatgtgac aattaaggtc ccggtcggca cccggataac ggacgtcgat       300
     accggtgagg tgctgggcga tatgacgcgc caccagcaga agttgatggt cggcaaaggg       360
     ggatggcatg gtctggggaa tacccgcttt aaatcttctg tcaaccgtac gccgcgccag       420
     aaaaccaatg gaacgccggg tgacaaacgc gatctgagcc tggagctgct gctgttggcc       480
     gacgttggca tgctggggct gcctaatgcc ggtaagtcca cctttatccg tgcggtgtct       540
     gccgccaagc cgaaggtggc tgattacccg tttaccacgc tggtgccaag cctgggcgtc       600
     gtgcgcatgg acagtgagaa gagcttcgtg gtggcggata ttccggggct gatagaaggc       660
     gcatcggaag gtgccggtct ggggatccgt ttcttgcgtc atctggagcg ttgccgggtg       720
     ctgctgcacc tgatcgatct cgcgccgatc gatgagtccg atccagtcga gaatgcccgg       780
     gtgatcatcg gtgagctgga gaagtatagc gagaagctgt ttcagaagcc gcgctggctg       840
     gtgttcaata aggctgacct gctggcaccg gaagaggcga aggcgcgcgc tcaggctatc       900
     gccgatgcgc tgggctggga aggcgagcac tatctgatct ctgcggccaa tcgcgaaggg       960
     gtgaacgcct tgtgctggga tgtgatgaat ttcctggaag cccatccgcg cgaagcggaa      1020
     gtggaagaag agaaagagaa ggccaagaaa gccgagttca tgtgggatga ctaccatcgt      1080
     gagcagctgg agcaggctga agccgagtgg gaagaggaag atgatgatga ctgggatgaa      1140
     gatgacgacg aaggcgtcga aatcatctat cagcgttaa                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page