(data stored in ACNUC7421 zone)

EMBL: CP001600.PE42

CP001600.PE42        Location/Qualifiers
FT   CDS_pept        37774..39261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0044"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67304"
FT                   /db_xref="GOA:C5B9C4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C4"
FT                   /protein_id="ACR67304.1"
FT                   /translation="MSSISSVIKSIQDIMRKDAGIDGDAQRLGQLSWLLFLKVFDAQEE
FT                   ELEFEQDNYRCPIPERFLWRNWAADSEGLTGDALLDFVNNDLFDSLKNQPANIDLNPRG
FT                   YVVKEAFSDAFNYMKNGTLLKQVINKLNEIDFTDSSERHLFGDIYEQILRDLQSAGNAG
FT                   EFYTPRAVTRFMVNRIDPKLGERVMDPACGTGGFLACAFDHVKEHYVETAADHQTLQQQ
FT                   ILGVEKKQLPHLLCTTNMLLHGIEVPVQIRHGNTLDKPLSSWDSDIDVILTNPPFGGTE
FT                   EDGIEQNFPADLRTRETADLFLQLIIEALKKGGRAAVVLPDGTLFGEGVKTKIKQLLTS
FT                   ECNLHTIVRLPNGVFAPYTGIKTNILFFTKGQPTQDVWFYQHPYPAGVKSYSKTKPMKF
FT                   EEFEAEIAWWGDEADGFAARVENEQAWKVSIETIIERNFNLDIKNPHVGEQISHDPDEL
FT                   LARYATEQAEIQILRDQLKTILGDALGKGTAKQEGQA"
     atgtcatcca tcagctcagt tatcaaatcc attcaggaca tcatgcgtaa ggacgccggt        60
     atcgacggtg atgcccagcg cctcggccag ctatcctggc tgctgttttt gaaagtgttc       120
     gacgcccagg aagaggagct ggagtttgaa caggataact accgctgccc catccccgag       180
     cgcttcctgt ggcgtaactg ggcggccgac agcgaagggc tgaccggcga tgccctgctc       240
     gatttcgtca acaacgatct gttcgacagc ctgaaaaacc agccagccaa tatcgatctc       300
     aacccccgtg gttatgtggt gaaagaggcg ttcagcgatg cctttaacta tatgaaaaac       360
     ggcaccctgc tcaagcaggt gatcaacaag ctcaacgaga tcgactttac cgacagcagc       420
     gagcgtcatc tattcggtga tatctacgag cagatcctgc gcgacctgca aagcgccggt       480
     aacgcgggcg agttctacac cccccgcgcc gtcacccgct ttatggtcaa ccgcatcgac       540
     cccaagcttg gcgagcgggt catggacccg gcctgcggca ccggtggctt tctcgcctgc       600
     gccttcgacc atgtcaaaga gcactatgtc gagaccgctg ctgaccacca gaccctgcag       660
     cagcagatcc tgggggttga gaagaagcag ctgccgcacc tcctttgcac taccaatatg       720
     ctgctgcacg gtatcgaggt gccggtgcaa attcgccatg gcaacaccct cgacaaaccg       780
     ctgtcgagct gggacagtga tatcgatgtg atcctcacca acccgccctt tggtggaacc       840
     gaagaggatg gtatcgagca gaacttccct gccgatctgc gcacccgtga aaccgccgac       900
     ctgttcctgc aactgattat cgaggccctg aaaaagggcg gtcgtgccgc tgtggtgctg       960
     cccgatggca ccctgtttgg ggaaggcgtt aaaaccaaga tcaagcaact gctcaccagc      1020
     gagtgtaacc tgcacaccat cgtgcggctg cccaacggcg tgtttgcccc ctataccggc      1080
     atcaagacca atatcctgtt ctttaccaag ggccagccca cccaggatgt ctggttctac      1140
     cagcacccct atccggctgg ggtgaagagc tacagcaaaa ccaagccgat gaagttcgag      1200
     gagtttgagg ccgagatcgc ctggtggggc gatgaggcgg acggctttgc tgcccgggta      1260
     gagaacgagc aagcgtggaa ggtcagcatc gagaccatta tcgagcgtaa ctttaacctc      1320
     gatatcaaaa acccccatgt gggcgagcag ataagccatg accccgatga gctgctggcg      1380
     cgctatgcca cagaacaggc cgagatccag atcctgcgtg accaacttaa aaccattctc      1440
     ggtgatgcct taggcaaggg cacggccaag caggagggac aggcataa                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page