(data stored in ACNUC7421 zone)

EMBL: CP001600.PE420

CP001600.PE420       Location/Qualifiers
FT   CDS_pept        complement(453206..454279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0453"
FT                   /product="two-component signal transduction histidine
FT                   kinase, putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67691"
FT                   /db_xref="GOA:C5BFA5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA5"
FT                   /protein_id="ACR67691.1"
FT                   /translation="MISLRRTLLIMLALILLVTQLVSALWLWHESREQISFLVNETLST
FT                   KVRTEQVDKEIHAAIAALLIPSLVMMAVTLLLSWLAVSWIVRPLNQLQARLEKRSPSNL
FT                   TPIDIDSSMTEITSITRTLNHLFSRLQHTLRQERLFTADAAHELRTPLAGVRLHLELME
FT                   QSGVQEATMLVQRIDQLMHTVEQLLMLSRVGQNFASGHYPQLELINEVVLAQRSELCEM
FT                   LALRGQHLRLETPSQIPMHGDAMLLRLMLRNLVENAHRYSPEGSDILLRVTLSTDGHGS
FT                   ILQVIDRGPGIDESRASELTEPFHRLDRRFGGSGLGLNIVVRILQLHKGQLTLRNNRPG
FT                   PGLNACCYLPLTPQDFG"
     gtgatcagcc tgcgccgtac gctgctcatt atgctggcgc tgatcctgct ggtcacccaa        60
     ttggtcagcg cactgtggct atggcatgaa agccgggaac agataagttt tctggttaac       120
     gaaaccctca gcaccaaggt acgcacggag caggttgata aagagatcca cgcagccatt       180
     gccgctctgc tgatcccctc tctggtgatg atggctgtta cgctgctgct ttcctggctg       240
     gccgtcagtt ggatagtccg cccgcttaac cagctacagg cgcggttaga gaaacggtcg       300
     cccagtaacc tgacgcccat cgatatcgac agcagtatga cggagatcac ctcgattacc       360
     cgtaccctca accacctgtt tagccgcctg cagcataccc tgcgccagga gcgtctgttc       420
     acggccgatg ccgcacacga gctacgcacc cccctcgccg gcgtacgcct gcaccttgag       480
     ctcatggaac agagtggagt acaggaagcc actatgctgg tgcagcgcat cgatcaactg       540
     atgcacacgg tcgagcagct gctgatgctg tcgcgtgtcg gacagaattt tgccagcggc       600
     cactatccac agctggagct gataaacgag gtggtgctcg ctcagcgcag cgagctgtgc       660
     gagatgctgg cgctgcgcgg acagcacctg aggctggaga cgccgtcaca gataccgatg       720
     cacggcgatg cgatgctgct gcgcctgatg ctgcgtaatc tggtggagaa tgcccaccgc       780
     tacagccccg agggcagcga tattctcctg cgggttacgc tgagcacaga cgggcacggc       840
     agtatcctgc aggtcatcga cagaggaccc ggtatcgatg aatcacgggc cagcgagctg       900
     accgagccct tccaccgcct tgaccggcgt ttcggcggca gcggcctggg gctgaatatc       960
     gtggtgcgca tcctacagct gcacaaggga cagctcaccc tgcgcaataa ccgcccggga      1020
     ccaggactca acgcctgctg ctatctgccg ctgacgccgc aggatttcgg ttaa            1074
//

If you have problems or comments...

PBIL Back to PBIL home page