(data stored in ACNUC7421 zone)

EMBL: CP001600.PE421

CP001600.PE421       Location/Qualifiers
FT   CDS_pept        complement(454276..454938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0454"
FT                   /product="two-component transcriptional regulator protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67692"
FT                   /db_xref="GOA:C5BFA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA6"
FT                   /protein_id="ACR67692.1"
FT                   /translation="MKILIVEDDTLIQQGLAQAMARENYAYDCADSAVGASALLQSSHY
FT                   SLIILDLGLPDIDGANALRQWRREGIDAPVLILTARDTVSDRVDGLDAGADDYLVKPFA
FT                   LAELLARVRALIRRMQGLCNNFLQVDDIHLDLSSQQVTCGGQALEITPKEFAILARLMM
FT                   RAGQTINREVLQQDLYSWQDGLSSNSLEVHIHNLRRKLGKKRIKTLRGVGYRLEKTQ"
     atgaagatcc tgatcgtgga agacgatacc ctgatccagc aggggctggc ccaggcgatg        60
     gcgcgggaaa actatgccta tgactgtgcg gacagcgcag taggcgccag tgcactgctg       120
     cagagcagcc actacagcct gatcatcctc gatctggggc tgcccgacat agacggcgcc       180
     aacgcgctgc gtcagtggcg gcgcgaaggt atcgacgcgc cggtgctaat cctcaccgcc       240
     cgcgacaccg tcagcgatcg tgtcgatggg ctggatgccg gtgccgatga ctatctggtt       300
     aagccttttg cactggccga gctgctggcg cgcgtccgcg ccctgatccg ccgtatgcag       360
     gggctgtgca acaactttct gcaggtcgat gatattcatc tggatctctc cagccagcag       420
     gtcacctgcg gcggccaggc gctggagatc accccaaaag agttcgccat cctggcacgc       480
     ttgatgatgc gcgcagggca gactatcaac cgtgaagtcc tacagcagga tctctactcc       540
     tggcaggatg gactcagctc caactcgctg gaggtacata tccataacct acggcgcaaa       600
     ctggggaaaa aacgcataaa aaccctgcgc ggcgtcggct atcggctgga gaagacgcag       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page