(data stored in ACNUC7421 zone)

EMBL: CP001600.PE424

CP001600.PE424       Location/Qualifiers
FT   CDS_pept        complement(457247..457540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0457"
FT                   /product="conserved hypothetical protein TIGR00253"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67695"
FT                   /db_xref="GOA:C5BFA9"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA9"
FT                   /protein_id="ACR67695.1"
FT                   /translation="MNLTNKQKQHLKSLAHSLKPVVQLGANGLTEGVLAEIEQALAHHE
FT                   LIKVRIAAEERDTKTLIANAIVRETGAYNVQLIGNILVIYRPSEERKISLPR"
     atgaatctga ctaacaagca aaaacagcac ctgaaaagct tggcccattc gctgaagcct        60
     gttgtgcaac tcggcgcgaa cggccttacc gaaggggtgc tcgcagaaat tgaacaggcg       120
     ctggcgcacc atgagctgat caaggtaagg atcgccgctg aagagcgcga caccaaaacc       180
     ctgatcgcca acgccatcgt ccgtgaaacc ggtgcgtaca acgttcagct gatcggtaac       240
     atcctggtga tttaccgccc gagcgaagaa cgcaagatca gtttaccccg ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page