(data stored in ACNUC7421 zone)

EMBL: CP001600.PE425

CP001600.PE425       Location/Qualifiers
FT   CDS_pept        457671..458297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0458"
FT                   /product="ribosomal RNA large subunit methyltransferase J,
FT                   putative"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67696"
FT                   /db_xref="GOA:C5BFB0"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFB0"
FT                   /protein_id="ACR67696.1"
FT                   /translation="MGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQGTD
FT                   KIFRPGMTVVDLGAAPGGWSQYVVTQIGDKGRVIACDLLPMDPIVGVDFLQGDFRDELV
FT                   LAALMERVGDAKVQVVMSDMAPNMSGTPSVDIPRAMYLVELAFEMAKDVLAPGGSFVVK
FT                   VFQGEGFDEYLGQIRSLFTKVKIRKPEASRARSREVYIVATGRKL"
     atgggtaaaa aacgttcggc cagttcgagt cgctggttac aggaacattt tagcgataaa        60
     tatgtgcagc aggcacagaa aaaggggctg cgttcgcgcg cctggtttaa actggacgag       120
     atccagggca cggataagat cttccgacca ggcatgaccg tggtagattt gggcgctgcg       180
     cccgggggat ggtcacaata tgtggtcaca caaatcggcg ataaaggtcg ggtgattgcg       240
     tgtgatcttt tacctatgga tcctatcgtt ggcgtcgatt tcctccaggg cgattttcgt       300
     gatgaattgg tgctggcggc gctgatggag cgagtgggtg atgccaaggt gcaggtggtg       360
     atgtctgaca tggcacccaa tatgagcggc accccttccg tagatattcc gcgtgccatg       420
     tatctggttg aattggcgtt tgaaatggcc aaagatgttc tggcacccgg tggtagtttt       480
     gtggtgaagg tctttcaggg agagggattt gacgagtatc tgggccagat ccgctccctg       540
     tttacgaagg tgaagattcg taagcctgaa gcttcgcgcg cgcgttcgcg cgaagtgtac       600
     atcgtagcga cagggcggaa actgtag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page