(data stored in ACNUC7421 zone)

EMBL: CP001600.PE429

CP001600.PE429       Location/Qualifiers
FT   CDS_pept        462752..463087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0462"
FT                   /product="preprotein translocase, SecG subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67700"
FT                   /db_xref="GOA:C5BFB4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFB4"
FT                   /protein_id="ACR67700.1"
FT                   /translation="MYEALLVIFLLISVALIALIMLQQGKGADMGASFGAGASATLFGS
FT                   SGTGNFMTRTTGILATLFFVLSLVLGNLSGHQSKQGSEWDNLGQPMKTEQPAKPAVPAT
FT                   PSSDIPN"
     atgtatgaag ctcttttggt aattttcctg ctgatatctg tggcgctgat cgccctgatt        60
     atgctgcagc agggtaaagg tgctgacatg ggcgcttcat tcggcgcagg cgcttcagcg       120
     acgctgtttg gctctagcgg taccggtaac tttatgaccc gtactacggg tatcttagcc       180
     acactgtttt tcgtgctgag cctggtgctg ggcaacctga gcggtcatca gagtaaacaa       240
     ggcagtgagt gggataatct gggtcagcct atgaagactg aacagcctgc gaaaccggca       300
     gtgccggcta cgccgagcag cgatattccg aactga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page