(data stored in ACNUC7421 zone)

EMBL: CP001600.PE43

CP001600.PE43        Location/Qualifiers
FT   CDS_pept        39261..41018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0045"
FT                   /product="type I restriction-modification system, S
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67305"
FT                   /db_xref="GOA:C5B9C5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C5"
FT                   /protein_id="ACR67305.1"
FT                   /translation="MAIENLITDHLDLWTAAVRPKSSAGRGASSKLELTGIKKLRELIL
FT                   ELAVRGKLVSQDPCDEPASVLLERIAAEKARLVKEGKLKKPKALPEISEEEQPFDLPEG
FT                   WAWGSIGYITEFVNGYAFKSSDFASEGVGIVKIGDIQDGEIVVDNMSRVSQHVVDGLNE
FT                   NLQVKSGDMLIAMSGATTGKLGFNKTDEIFYLNQRVGKFITYLVDKEFLYYPLATKIAE
FT                   NLAKAMGSAIPNISTKQINEITIALPPLAEQHRIVAKVDELMALCDQLEQCSESQLAAH
FT                   QTLVEALLATLTDSSDTEELAQNWARLNTHFDTLFTTEASIDALKQTILQLAVMGKLVQ
FT                   QDPSDEPASALLARIAAEKAQLIKEKKIKKEKPLPAISEDEKPFSLPKGWDFAYMQDLC
FT                   YLITDGTHQTPKYTDDGRPFISAQCVKPFRFMPEFCRYVSEEHYQLYIKNRRPEFGDIL
FT                   LSRVGAGIGEAAVIDSCLEFAIYVSTGLLKPNRGAVYSKYLELWLNSPIGRGFSERNTL
FT                   GKGVSQGNLNLSLIRSFIVSLPPKKEQKLIVAKVGEMITLCDQLKSCLQTSQQTQLALA
FT                   ESLVEGAIA"
     atggcgatcg agaatctgat taccgaccat ctggatctct ggactgcggc ggtgcgcccc        60
     aaaagcagtg cggggcgcgg cgcgagcagc aagctagaac tcaccggcat caaaaaactg       120
     cgtgagctga ttttggagct ggccgtgcgc ggcaaactgg tgtcacaaga cccctgcgat       180
     gaacctgctt ctgtgctgct ggagcggatt gctgccgaaa aggcgcggtt ggtgaaagag       240
     ggtaagctta aaaagcccaa ggccttgccg gaaattagcg aggaagagca gccttttgat       300
     ctaccagagg ggtgggcgtg gggaagtatt ggatatatta ctgagtttgt taatggctac       360
     gcatttaaaa gttctgactt tgcatctgag ggggttggaa ttgtaaaaat cggcgatatt       420
     caagatggtg agatagtagt cgataacatg tcgcgagtat cacagcatgt agttgatggg       480
     ctgaatgaga atcttcaggt gaaatctggg gatatgctaa tcgctatgtc tggagcgaca       540
     actggaaagt taggtttcaa taaaactgat gagatatttt atctcaatca acgagtcggc       600
     aagttcataa catacttggt ggataaagaa ttcctttact atccattagc gacaaagatt       660
     gctgaaaatc ttgccaaagc catgggaagt gcgattccaa atataagtac caagcaaata       720
     aatgaaatta ctatcgctct gccaccgtta gctgagcaac accgcatcgt tgccaaagtg       780
     gatgagttaa tggctctttg cgaccagttg gagcagtgca gcgagtcgca gctggcggcc       840
     catcagacgc tggtggaggc cctgctcgcc acgctgactg actccagcga taccgaagag       900
     ctggcgcaaa actgggcgcg gttaaacact cactttgata ccctctttac caccgaggcc       960
     agcatcgacg ctttgaaaca gaccatcctg caactggcag tgatgggcaa gctggtacag      1020
     caagacccga gcgatgaacc tgcctcagcc ctgctggcgc gcatcgccgc cgaaaaagcg      1080
     cagctgatca aagagaagaa aatcaaaaaa gaaaaaccgc tacctgcgat tagcgaggat      1140
     gaaaaaccat tttccttacc caaaggttgg gatttcgcat acatgcaaga tttatgttat      1200
     ctgataacgg atggaacaca tcaaacacct aaatatacag atgatggtag gccgtttatt      1260
     tctgctcagt gtgtaaaacc attcagattt atgccggagt tttgtcgtta cgtatccgaa      1320
     gaacactacc agttatatat aaaaaatcgg aggccagaat ttggtgacat cttattatct      1380
     cgtgtcggtg caggcattgg agaagcagct gttattgatt cttgtttaga atttgcaata      1440
     tacgtaagta ccggattact taaacccaat aggggtgcag tttattccaa gtacctagaa      1500
     ctctggctta actcacctat cggtagaggt ttttcagaga gaaatacttt gggaaaaggt      1560
     gtttcacaag ggaatcttaa tctttctttg ataagaagtt ttattgttag cctgccacca      1620
     aagaaagaac aaaaactcat agtcgctaaa gtcggtgaga tgataaccct ctgcgaccaa      1680
     ctaaaatctt gcctgcaaac cagccagcag acccaacttg ccctggccga gtcgctggtg      1740
     gaaggagcga ttgcctga                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page