(data stored in ACNUC7421 zone)

EMBL: CP001600.PE430

CP001600.PE430       Location/Qualifiers
FT   CDS_pept        463606..464028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0465"
FT                   /product="hypothetical protein"
FT                   /note="Uncharacterized BCR, YhbC family COG0779"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67701"
FT                   /db_xref="GOA:C5BFB5"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFB5"
FT                   /protein_id="ACR67701.1"
FT                   /translation="MITAPVEALGFELVGIEFIRGRHSTLRIYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVAYYLEVSSPGMERPLFIAEHYTRFLNEEVTLVLRMAMQNRRKWQ
FT                   GIIKAVDGEMITVTVDGKDEVFALSNVQKANLVPHF"
     atgattacgg cgccagtaga agccctgggc tttgagctgg ttggtattga gttcatccgt        60
     ggtcgccatt caacgctgcg aatctatatc gatagtgaag aaggcatcac tgttgataat       120
     tgtgctgatg ttagccacca ggtcagcgcc gttcttgacg tagaagatcc gatttcagtc       180
     gcctattacc tggaagtctc ctcaccgggg atggagcgcc ccctgtttat cgctgaacat       240
     tacacccgtt ttctgaatga ggaagtgacg ctggtactgc ggatggcgat gcagaaccgc       300
     cggaagtggc agggtatcat caaggcagta gacggcgaga tgattacggt cacggttgat       360
     ggcaaagatg aagtgttcgc gctgagcaat gtccagaaag cgaacctggt accccacttt       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page