(data stored in ACNUC7421 zone)

EMBL: CP001600.PE435

CP001600.PE435       Location/Qualifiers
FT   CDS_pept        469874..470143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0470"
FT                   /product="30S ribosomal protein S15, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67706"
FT                   /db_xref="GOA:C5BFC0"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFC0"
FT                   /protein_id="ACR67706.1"
FT                   /translation="MSLSVEAKAKIVAEFGRDANDSGSTEVQVALLTAQINHLQGHFAE
FT                   HKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYSSLIERLGLRR"
     atgtctctaa gcgttgaagc gaaagctaaa atcgttgctg agttcggtcg tgatgccaac        60
     gacagcggtt ccaccgaagt gcaggttgca ctgctgaccg cgcagattaa ccacctgcag       120
     ggccactttg ctgagcataa aaaagatcac cacagccgtc gtggtctgct gcgcatggtt       180
     tcccagcgtc gtaagctgct ggactacctg aagcgtaaag atgtagcacg ttactccagc       240
     ctgatcgagc gtctgggtct gcgtcgctaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page