(data stored in ACNUC7421 zone)

EMBL: CP001600.PE437

CP001600.PE437       Location/Qualifiers
FT   CDS_pept        472638..473522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0473"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67708"
FT                   /db_xref="GOA:C5BFC2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC2"
FT                   /protein_id="ACR67708.1"
FT                   /translation="MKPILRWCYVATAILLAGCSNADWRQNEVLAIPLQPSLQQEVMLA
FT                   RMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGI
FT                   YLTQAGNFDAAYEAFDSVLELDPTYSYARLNRGIALYYGGRYSLAQDDLQAFYQDDPND
FT                   PFRSLWLYLAERELNQDQALTALSQRYNKANRSQWGWNIVEFYLGKISEKTLMERLQAD
FT                   ATDNTSLAEHLSETDFYLGKHYLSLGEKSSASALFKLTVANNVHNFVENRYALLELARL
FT                   GQEQDDIPESDQQ"
     atgaagccta tcttgcgctg gtgttatgtt gcgacagcaa ttctgttggc aggatgcagc        60
     aacgctgatt ggcgccaaaa cgaagtactg gccattcctt tgcagccttc gctgcagcag       120
     gaggtaatgc tggcgcgcat ggagcagatc cttgccagcc gggcattaac ggatgatgaa       180
     cgcgcacagc ttctctatga gcgcggagta ctgtatgata gtctcgggct gagggcgtta       240
     gcgcgtaacg atttttcgca ggcgctggcc attcgtcctg atatgccaga agtttttaac       300
     tatctgggta tttatttaac gcaggcaggc aactttgatg ccgcctatga agcgtttgat       360
     tctgtactag agcttgatcc aacttatagc tatgcgcgtt taaatcgcgg tattgccctc       420
     tactatggtg ggcggtattc gttagcgcaa gatgatctgc aggcgtttta tcaagacgat       480
     cccaacgatc cgttccggtc gttatggctt tacctggctg agcgtgagct taaccaggat       540
     caggcgctta cggcgctgag ccagcgctac aataaggcga accggagtca atggggatgg       600
     aatattgtcg aattctacct gggcaaaatc agcgagaaaa cgctgatgga acgcctacag       660
     gcagatgcaa cggataacac ttcgctcgct gagcatctca gtgaaactga cttctattta       720
     ggtaaacatt acctgagtct gggggagaag agcagtgctt ctgcgctgtt caaactgacg       780
     gtggccaaca acgttcataa ctttgttgag aaccgttacg cactgttgga attggcccgc       840
     ttgggtcaag agcaagacga cataccagaa tcggaccagc aataa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page