(data stored in ACNUC7421 zone)

EMBL: CP001600.PE439

CP001600.PE439       Location/Qualifiers
FT   CDS_pept        complement(475587..475766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67709"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC4"
FT                   /protein_id="ACR67709.1"
FT                   /translation="MSVISGFIDAAHILVEYSFFYYLNKFKNKALVTHISRDHKKGQPE
FT                   GWPFTRLPLLITHH"
     gtgtctgtta tctcaggttt tatagatgca gcgcatattt tagttgagta ttcttttttt        60
     tattatttga ataagtttaa aaataaagca ttagtcactc acataagccg ggaccataaa       120
     aaaggccagc ccgaaggctg gccttttacg cgcttaccgt tgctgattac gcatcattaa       180
//

If you have problems or comments...

PBIL Back to PBIL home page