(data stored in ACNUC7421 zone)

EMBL: CP001600.PE440

CP001600.PE440       Location/Qualifiers
FT   CDS_pept        476178..477509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0476"
FT                   /product="inner membrane transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67711"
FT                   /db_xref="GOA:C5BFC5"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC5"
FT                   /protein_id="ACR67711.2"
FT                   /translation="METTQMSSVILAGHPAVTRDGMSDSEWWAATRFDSTDVGWVMMSI
FT                   GMAIGAGIVFLPVQVGLMGLWVFLLSSVVGYPAMYLFQRLFINTLAESPECRDYPSVIS
FT                   GYLGKNWGILLGGLYFVMLVIWMFVYSTAITNDSASYLHTFGVTEGLLSENPFYGLALI
FT                   CVLVAISSRGEQLLFKLSSFMVLTKLLVVAALGIAMVGMWHLYNVGALPPLGLLVKNAV
FT                   ITLPFTLTSILFIQTLSPMVISYRAHCKSREVARYKALRAMNIAFGVLFVTVFFYAVSF
FT                   TLAMGHDEAVKAYQQNISALAIAAQFIDGGIDNWVTVVSVILNIFAVMTAFFGVYLGFR
FT                   EATQGIVMNLLRRMVPPERIKERWVQGSIMALAVLLAWGAIILNAPVLSFTSICSPIFG
FT                   MVGCLIPAYLVYRVPALHKYKGVSLLVIIITGLLLCISPLLAFF"
     atggaaacga cacaaatgag cagtgtgata ctagcgggtc accccgctgt cacccgggat        60
     ggtatgagcg acagcgagtg gtgggcggcc acccgttttg acagtaccga tgtgggctgg       120
     gtgatgatga gcatcgggat ggcgattggc gccggtattg tctttttgcc ggttcaggtt       180
     gggctgatgg gactgtgggt tttcctgttg tcgtccgttg tgggctatcc ggcgatgtat       240
     ttgtttcagc gcctgtttat caacaccctg gccgagtcgc cggagtgccg tgattatccc       300
     agcgtgatca gcggttacct ggggaaaaac tggggtattt tgttgggggg actctacttc       360
     gtgatgctgg tgatttggat gttcgtctac tccaccgcca ttaccaatga cagcgcctcc       420
     tacctgcata ctttcggtgt gacggaaggg ctgctctcgg aaaacccctt ttacgggttg       480
     gcgctgatct gtgtcttggt ggctatctca tctcgcggag agcagctgtt gtttaagctt       540
     tccagcttta tggtgctgac caaacttctg gtagtggctg cgctggggat tgctatggtc       600
     ggaatgtggc atctgtataa cgtgggtgcg ctgccgccgc tggggctgct ggtgaaaaat       660
     gcggtgatca cgctgccgtt taccttgacc tcgatcctat tcattcagac gctcagtccg       720
     atggttatct cataccgggc gcactgcaaa tcgcgcgaag ttgcccgcta caaggcgttg       780
     cgcgccatga acatcgcctt cggcgttctg ttcgtgacgg tcttcttcta cgcggtctcc       840
     ttcacgctgg cgatggggca cgacgaggcg gttaaggcct atcagcagaa tatctccgcg       900
     ctggctatcg ccgcgcagtt catcgatggt ggaatcgata actgggttac cgtggtgagc       960
     gtcatcctga atatctttgc ggtgatgacg gcattcttcg gggtgtatct gggctttcgc      1020
     gaagccactc agggaatcgt gatgaatctg ctgcggcgca tggttccacc ggagcggatt      1080
     aaggagcgtt gggttcaggg cagcatcatg gcgcttgccg ttctgctcgc ctggggagct      1140
     attattctca atgcgccggt gctgagcttc acctctatct gcagcccgat ctttggcatg      1200
     gtgggatgcc tgatccccgc gtatctggtg taccgggttc cggcgctgca taagtataaa      1260
     ggtgtgtccc tattggtgat tatcatcacc gggctgctgc tgtgtatctc gccgctgctg      1320
     gcctttttct aa                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page