(data stored in ACNUC7421 zone)

EMBL: CP001600.PE441

CP001600.PE441       Location/Qualifiers
FT   CDS_pept        477884..478153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67712"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC6"
FT                   /protein_id="ACR67712.1"
FT                   /translation="MGAAVGIAWLIDGRYEVVAMSIGSMSGDVSGMICDGASNSCTMKV
FT                   SISLSAAFKVVLMAQDNSAMSGNERIVAHDVDHSIATCACWPVA"
     atgggcgcgg cggtcggtat tgcatggctt atcgacggtc gctatgaggt ggtagctatg        60
     tcaatcggca gtatgagcgg tgatgtaagc ggaatgattt gcgatggggc ttccaatagc       120
     tgcacgatga aggtttccat cagcctcagc gctgcgttca aggtagtgct gatggcacag       180
     gacaacagcg cgatgagtgg taatgagagg atcgtggcgc acgacgtgga tcactcaatc       240
     gctacctgtg cttgctggcc agtggcgtaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page