(data stored in ACNUC7421 zone)

EMBL: CP001600.PE443

CP001600.PE443       Location/Qualifiers
FT   CDS_pept        complement(479304..480299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0479"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67714"
FT                   /db_xref="GOA:C5BFC8"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC8"
FT                   /protein_id="ACR67714.1"
FT                   /translation="MELLCPAGNLPALKAAVENGADAVYIGLKDDTNARHFAGLNFNEK
FT                   KLQEALEYVHQRGRKLHIAINTFAHPDGYIRWQRAVDMAAQLGADALILADLAMLEYAA
FT                   ERYPHIERHVSVQASVTNEEAIRFYQRHFAVARVVLPRVLSLHQVKQLARCSPVPLEVF
FT                   AFGSLCIMSEGRCYLSSYLTGESPNTAGACSPARFVRWQQTPQGMESRLNDVLIDRYAN
FT                   NENAGYPTLCKGRYLVDGVRYHTLEEPTSLNTLTLLPALMEANIASVKIEGRQRSPAYV
FT                   SQVTRVWRQAIDRCRHDPEHFTPDAAWMEALGAVSEGAQTTLGAYHRRWQ"
     atggagctgc tgtgccccgc cggcaaccta cccgccctca aagcggccgt agagaatggt        60
     gccgacgctg tctatattgg actgaaagac gatactaatg cccgccattt cgccggcctc       120
     aattttaatg aaaaaaagct gcaggaagca ctggagtatg tgcaccaacg cggccgtaag       180
     ctgcatatcg ctatcaatac ctttgcccac cccgatggct acatccgctg gcagcgggcg       240
     gtggatatgg ccgcccagct gggtgcggac gcgctgatcc ttgccgattt ggccatgctg       300
     gagtacgccg ccgaacgtta cccccacatt gaacgccacg tttcggtaca ggcatcggta       360
     actaacgagg aagcgatccg cttttaccag cgtcactttg cagtcgcacg cgtggtgttg       420
     ccgcgcgttc tttcactgca tcaggtaaaa cagctggcgc gctgcagccc ggttccgttg       480
     gaggtcttcg ccttcggtag cctgtgtatc atgtccgagg gacgctgcta cctctcctcc       540
     tacctgaccg gagagtcccc caataccgcc ggtgcctgtt cgcctgcccg cttcgtgcgc       600
     tggcagcaga ccccgcaggg tatggagtcc cgcctcaacg acgtcctgat cgatcgctat       660
     gccaataacg aaaatgcggg ctatcccaca ctgtgcaagg ggcgctacct ggtcgacggc       720
     gtgcgttacc atacgctgga ggagccgacc agcctgaata cgctcacgct gctgccggcg       780
     ctgatggagg ccaatatcgc ctcggttaaa atcgagggtc gccagcgcag cccggcctat       840
     gtcagccagg taacgcgggt gtggcgacag gctatcgatc gctgccgtca cgatcctgaa       900
     cactttaccc ccgacgccgc ctggatggag gcgctcggcg ccgtttcaga aggcgcgcag       960
     accactctcg gcgcctatca ccgccgatgg cagtaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page