(data stored in ACNUC7421 zone)

EMBL: CP001600.PE444

CP001600.PE444       Location/Qualifiers
FT   CDS_pept        480605..481126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0480"
FT                   /product="SCP-2 sterol transfer family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67715"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016830"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC9"
FT                   /protein_id="ACR67715.1"
FT                   /translation="MLEQLRARIVRQGPAFLSLPLKVTPFVLQRHVLEQLLSWQFRQAL
FT                   AEGDLAFLDGRWLQVDVCDLGLRWFVTVQQGMLRVSRHQQADVSFSADANDLILIAASK
FT                   EDPDTLFFQRRLRIEGDTELGLQVKNLMDAIDPELMPAPLRLALMQLADFVEAGLREGT
FT                   PIDARAVTSC"
     gtgttggaac aattgcgagc acgcatcgtg cgtcagggac cggcattctt gagtctgccg        60
     ttaaaagtta cgccgtttgt cctgcagcgg catgtgttgg aacagttgct gtcctggcag       120
     tttcgtcagg cgttggctga gggcgatctg gcgtttcttg acgggcgttg gctacaggtt       180
     gacgtgtgcg atcttggtct gcgctggttt gtcaccgtgc agcaggggat gctgcgcgtt       240
     agccgtcatc aacaggcgga tgtcagcttc agcgcagatg ctaacgatct gatcctgatc       300
     gctgccagca aagaggatcc cgatacgctt ttcttccagc gtcgcctgcg tattgaggga       360
     gataccgagc tggggctgca ggttaaaaat ctgatggatg ctatcgatcc tgagctgatg       420
     ccggcgccgc tgcgcctggc gctgatgcag ctggcggatt ttgtagaggc tggtctgcgg       480
     gagggcacgc cgatcgatgc gcgtgcggtg acatcatgct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page