(data stored in ACNUC7421 zone)

EMBL: CP001600.PE446

CP001600.PE446       Location/Qualifiers
FT   CDS_pept        481721..481927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67717"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH34"
FT                   /protein_id="ACR67717.1"
FT                   /translation="MRGISLPASRIYRHLLRLSPRLIAYWAFHCRTAVRIRVIAQTAAV
FT                   SSVFRPQLHAVDSASFNNKKNGA"
     gtgcggggga taagtctgcc tgcttcacgc atttatcgcc atcttctgcg cctttcgccg        60
     cgcctgatcg cgtattgggc gtttcactgc cgtactgccg tacgcatccg ggtcatagcc       120
     cagacagcgg cggtatcatc tgtgtttcgc ccgcagctcc acgccgtgga cagcgcctcc       180
     tttaacaaca aaaaaaacgg tgcgtga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page