(data stored in ACNUC7421 zone)

EMBL: CP001600.PE448

CP001600.PE448       Location/Qualifiers
FT   CDS_pept        483822..484277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0484"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67719"
FT                   /db_xref="GOA:C5BH36"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH36"
FT                   /protein_id="ACR67719.1"
FT                   /translation="MINDDTLAAIRRFLTRQHVVTLAVGQGETLWCADCFYALDALPMT
FT                   LYLLTSPTSHHGRLMSANPRVAGTVAHQTRSVAKIQGIQFHGRIACLDGEDAAVAYAAY
FT                   YRRFPLARARPSPVWGLHLMRVKMTDNTCGFGHKRHWAREGEPVGVY"
     atgatcaacg acgatacgct ggcggccatc cggcgtttcc tgacccgcca gcacgttgtg        60
     acgctggcag ttgggcaggg ggagacgctg tggtgcgctg actgttttta tgcgctggat       120
     gcgctgccaa tgacgctgta cctgctgacc tcgccgacgt cccatcacgg gcggctgatg       180
     tcggccaatc cacgggtcgc tggtacggtg gcacatcaga cgcgcagcgt ggcgaagatc       240
     caggggatac agtttcacgg ccggattgca tgtcttgatg gagaggacgc ggcggtggcg       300
     tatgctgcct actatcgccg ttttccgctg gcgagggcca ggccatcgcc ggtctggggg       360
     ctgcacctga tgcgggtgaa gatgaccgat aatacctgtg gctttggcca taaacgtcat       420
     tgggcccgcg agggtgagcc agtgggggta tactag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page