(data stored in ACNUC7421 zone)

EMBL: CP001600.PE449

CP001600.PE449       Location/Qualifiers
FT   CDS_pept        484373..485023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0485"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67720"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH37"
FT                   /protein_id="ACR67720.1"
FT                   /translation="MYVLLLGATGLIGRALLTLLASDPRVTQIYAPTRTALPASDKLIN
FT                   PVGADICRAMLDWDTPCDVAFCCLGTTRKAAGSDSNFRYVDYSLVVECGAVALQHGCRH
FT                   YVVVSALGANAQSPFLFSRTKGEMEQALELQAWRRLSLLRPSLLQGERAKPRLLEQISE
FT                   PLFRLLPEKWKAIEADCVARAMLRCALYPAEYRLQILESEQVQRLGETVAGAL"
     atgtatgtat tgcttcttgg ggcgaccggc cttatcgggc gtgcgctact gacgctgttg        60
     gcgtcggatc cccgcgttac ccaaatctat gcgccgacgc gtacggcgtt gccggcgtcg       120
     gacaagctga ttaaccccgt cggtgcagac atttgccggg ctatgctgga ctgggatacc       180
     ccctgcgacg tggccttttg ctgcctggga accacccgca aagcagccgg tagcgacagc       240
     aattttcgct acgtggacta ctcgctggtg gttgagtgcg gtgcggtcgc gctgcagcat       300
     ggttgccgcc actatgtggt cgtcagcgcg ctgggggcca atgcccagtc gccgtttttg       360
     ttcagtcgca ccaaggggga gatggaacag gctttagagc tgcaggcctg gcgacgactc       420
     tctctgctgc gtccctccct gcttcaggga gagcgggcca agccgcgcct gctggagcag       480
     atttctgaac cgctgtttcg tctgctgcct gaaaaatgga aggcgatcga ggcagactgc       540
     gtggcgcgtg ccatgctgcg ttgtgcgctg tatccggcgg agtatcgcct gcagatcctg       600
     gagtctgagc aggtgcagcg tttgggagag acggtggcag gcgccctctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page