(data stored in ACNUC7421 zone)

EMBL: CP001600.PE45

CP001600.PE45        Location/Qualifiers
FT   CDS_pept        42432..43418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0047"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67307"
FT                   /db_xref="GOA:C5B9C7"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C7"
FT                   /protein_id="ACR67307.1"
FT                   /translation="MTLFHIANQQLTPLTQTTFAAEGLQERQDLQEALKRNIAVIAPDC
FT                   LVIADEFSDWEDSRRRIDLLAIDRNANLVVIELKRNEVGAHMELQALRYAAMITNMTFD
FT                   KACEYFAAYIEQEGLQIDARNTLLEFVDLDENQLDDFGNEVRIVLASADFGKELTTSVL
FT                   WLRDKGIDIRCVRLTPFRYQGEVLINAAQIIPLEEAESYQIQFREKRAEQRASQQGTRD
FT                   YSKYRFNGGVYNKRHFALAVLSHWIKDRQLADLAEITAYLAQFDLPRKVTPVDQIPEKN
FT                   LNRWHLGEGNLIELPSGEQIAISNQWGTDTERLLQGMTQLGYQIEKI"
     atgaccctct ttcatatcgc caatcaacaa ctgaccccgt taacccaaac cactttcgct        60
     gccgaagggc tgcaagagcg ccaagatctg caagaggcgt taaagcgcaa tatcgctgtc       120
     attgcccccg attgcctggt gattgccgac gaattctccg actgggaaga tagccgccgt       180
     cgtatcgatc tgctggccat cgaccgcaat gccaatctgg tagtgatcga gttaaaacgt       240
     aatgaagtcg gcgcacatat ggagctgcag gcactgcgct atgccgccat gatcaccaat       300
     atgacttttg ataaagcctg tgaatacttt gcggcctata tcgagcaaga agggctacaa       360
     atcgatgccc gcaacaccct gctggagttt gtcgatctgg acgaaaacca gctcgatgat       420
     ttcggcaatg aggtgcgcat cgttttggcg tcggctgact ttggcaaaga gctgaccacc       480
     tctgtgttgt ggctgcggga caagggcatc gatattcgct gtgtgcggct gaccccattc       540
     cgctatcagg gagaggtgct gatcaatgct gcgcagatca tcccgttaga agaggcagag       600
     tcctatcaga tccagtttcg agaaaagcgt gccgagcaac gggccagcca gcaaggtacc       660
     agagactaca gcaagtaccg ctttaacggc ggggtttaca acaaacgcca ttttgccctg       720
     gcggtactca gccattggat aaaagaccgg caacttgccg atctggccga gatcactgcc       780
     tatctggcgc aatttgatct gcccagaaag gtaacgccgg ttgaccagat cccggaaaaa       840
     aaccttaatc gctggcattt aggcgagggc aacctgattg agctgccatc gggtgagcag       900
     atcgccatct ccaaccagtg gggaaccgat accgaacggt tgctgcaggg gatgacacag       960
     ttgggctacc agattgaaaa aatctag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page