(data stored in ACNUC7421 zone)

EMBL: CP001600.PE450

CP001600.PE450       Location/Qualifiers
FT   CDS_pept        complement(485036..485500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0486"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein, putative"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67721"
FT                   /db_xref="GOA:C5BH38"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH38"
FT                   /protein_id="ACR67721.1"
FT                   /translation="MNYHQYYPVDVVNGPGTRCTLFVAGCVHQCPGCYNKATWRLDSGV
FT                   PFTAALEDRIIADLNDTRINHQGLSLSGGDPLHPHNVATILRLVQRVRAECRGKDIWLW
FT                   TGYRLEELTAEQQAVVNLINVLVDGKFVQDLKDPMLIWRGSSNQVVHCLR"
     atgaattacc atcagtatta tccggtcgat gtcgtcaacg gcccgggcac ccgctgcacg        60
     ctgttcgttg cgggctgcgt ccaccaatgc cccggctgct ataacaaagc cacctggcgc       120
     ctggactccg gcgtaccgtt cacggcggca ctggaggatc gcatcattgc cgatctcaac       180
     gatacccgga ttaaccatca ggggctctcc ctctcgggcg gtgacccgct gcacccgcat       240
     aacgtagcga cgatcctacg cttggtacag cgggtacgcg ccgagtgccg cggcaaagac       300
     atctggctgt ggacgggcta tcgcctggaa gagcttacgg cggaacagca ggccgtggtg       360
     aatctgatca atgtcttggt ggacggcaag tttgtacagg atctcaaaga tcccatgctg       420
     atctggcgag gcagcagcaa tcaagtcgtc cactgcctac gctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page